| Clone Name | rbast72b02 |
|---|---|
| Clone Library Name | barley_pub |
>TIE2_BRARE (O73791) Tyrosine-protein kinase receptor Tie-2 precursor (EC| 2.7.10.1) Length = 1116 Score = 30.4 bits (67), Expect = 1.7 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 6/75 (8%) Frame = -1 Query: 314 QLHHSLVQLSLVPGTVHKKKLRPV*NAGFSEESP------LSQETNIYIKIAAFATLFLL 153 QLH L L P T ++ +L V N G S ESP L Q+ + + AA L L Sbjct: 687 QLHMRFQLLGLRPNTGYQLQLWTVNNMGESAESPPVSLMTLPQQESSAL-FAAHGHLLLY 745 Query: 152 IVLGSKS*T*FTIVL 108 +LGS T T++L Sbjct: 746 AILGSAGMTCCTVLL 760
>YQ5B_CAEEL (Q09254) Hypothetical protein C16C10.11| Length = 154 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Frame = +3 Query: 327 MLAARTLAP----PVLTSPRPAAGRSAAGTPPAP 416 M+ RT +P PV ++PRPAA S A PP P Sbjct: 1 MVRRRTASPSPSAPVRSAPRPAAQSSFAAPPPRP 34
>K1267_HUMAN (Q7Z3B3) Protein KIAA1267| Length = 1105 Score = 30.0 bits (66), Expect = 2.3 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -3 Query: 285 ISTRYRPQKKVKACLKRRIFRGIALVPGDKYIYQNCSVRNAVPTN 151 ++ R RP V +C KRR+ R ++VP K +++N ++R N Sbjct: 589 VAARTRP---VLSCKKRRLVRPNSIVPLSKKVHRNSTIRPGCDVN 630
>WASIP_MOUSE (Q8K1I7) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) Length = 493 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 336 ARTLAPPVLTSPRPAAGRSAAGTPPAP 416 ++T PPV ++PRP G A PP P Sbjct: 279 SQTSKPPVPSTPRPGLGSQAPPPPPPP 305
>VP40_BHV1C (P54817) Capsid protein P40 [Contains: Assemblin (Protease) (EC| 3.4.21.97); Capsid assembly protein] Length = 621 Score = 29.3 bits (64), Expect = 3.8 Identities = 20/43 (46%), Positives = 22/43 (51%) Frame = +3 Query: 288 QLNQGMVKLARIIMLAARTLAPPVLTSPRPAAGRSAAGTPPAP 416 Q NQ +V AR AA T APP PAA +AA PP P Sbjct: 340 QYNQLVVSQARG---AAMTAAPPPAPYFLPAAAAAAAAPPPMP 379
>HXD13_HUMAN (P35453) Homeobox protein Hox-D13 (Hox-4I)| Length = 335 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 327 MLAARTLAPPVLTSPRPAAGRSAAGTPPAP 416 ++AAR APP P P +AA P AP Sbjct: 86 VVAARPEAPPAKECPAPTPAAAAAAPPSAP 115
>RAD50_SULSO (Q97WH0) DNA double-strand break repair rad50 ATPase| Length = 864 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -3 Query: 411 LEVYLRRIDLLQDEVKSALEEL 346 LE Y+R++ LLQ+EVK+ EE+ Sbjct: 606 LEDYIRQVKLLQEEVKNLREEV 627 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,402,264 Number of Sequences: 219361 Number of extensions: 1131323 Number of successful extensions: 3606 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3592 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)