| Clone Name | rbast72a09 |
|---|---|
| Clone Library Name | barley_pub |
>UPPS_STRA5 (Q8DXD5) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 250 Score = 30.8 bits (68), Expect = 1.3 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -1 Query: 186 LFCRSDSALLISSLLPWHPCNRHHHFVAVTSYDRLMDE*NEVIRDYHMPH 37 L R+ L +S+ LPW +F V D DE ++ I DY+ H Sbjct: 195 LIIRTSGELRLSNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRH 244
>UPPS_STRA3 (Q8E359) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 250 Score = 30.8 bits (68), Expect = 1.3 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -1 Query: 186 LFCRSDSALLISSLLPWHPCNRHHHFVAVTSYDRLMDE*NEVIRDYHMPH 37 L R+ L +S+ LPW +F V D DE ++ I DY+ H Sbjct: 195 LIIRTSGELRLSNFLPWQSAYSEFYFTPVLWPDFKKDELHKAIVDYNQRH 244
>LOXL4_BOVIN (Q8MJ24) Lysyl oxidase homolog 4 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 4) Length = 757 Score = 28.5 bits (62), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -1 Query: 138 WHPCNRHHHFVAV-TSYDRL 82 WH C+RH+H + V T YD L Sbjct: 608 WHQCHRHYHSIEVFTHYDLL 627
>LOXL4_HUMAN (Q96JB6) Lysyl oxidase homolog 4 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 4) (Lysyl oxidase-related protein C) Length = 756 Score = 28.5 bits (62), Expect = 6.4 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -1 Query: 138 WHPCNRHHHFVAV-TSYDRL 82 WH C+RH+H + V T YD L Sbjct: 607 WHQCHRHYHSIEVFTHYDLL 626
>LOXL4_MOUSE (Q924C6) Lysyl oxidase homolog 4 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 4) (Lysyl oxidase-related protein C) Length = 757 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -1 Query: 138 WHPCNRHHHFVAV-TSYDRL 82 WH C+RH+H + V T YD L Sbjct: 608 WHQCHRHNHSIEVFTHYDLL 627 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,112,471 Number of Sequences: 219361 Number of extensions: 856133 Number of successful extensions: 2021 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2020 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)