| Clone Name | rbast72a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL4_TREDE (P61070) 50S ribosomal protein L4 | 28 | 5.2 | 2 | INSL3_BOVIN (O77801) Insulin-like 3 precursor (Leydig insulin-li... | 27 | 8.8 | 3 | RNH_THET8 (P29253) Ribonuclease H (EC 3.1.26.4) (RNase H) | 27 | 8.8 | 4 | RNH_THET2 (Q72IE1) Ribonuclease H (EC 3.1.26.4) (RNase H) | 27 | 8.8 | 5 | RL4_TREPA (O83220) 50S ribosomal protein L4 | 27 | 8.8 |
|---|
>RL4_TREDE (P61070) 50S ribosomal protein L4| Length = 211 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 118 HKRIATAITPNRHILDGGTGRPPLQRVSAEARRSD 222 +KR+ TA T R + G +P Q+ + ARR D Sbjct: 42 NKRVGTACTKGRAEVHGSNSKPYSQKGTGRARRGD 76
>INSL3_BOVIN (O77801) Insulin-like 3 precursor (Leydig insulin-like peptide)| (Ley-I-L) (Relaxin-like factor) [Contains: Insulin-like 3 B' chain; Insulin-like 3 B chain; Insulin-like 3 A chain] Length = 132 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 103 STRH*HKRIATAITPNRHILDGGTGRPPL 189 ++RH H R ATAI P RH G R L Sbjct: 98 ASRHHHHRRATAINPARHCCLSGCTRQDL 126
>RNH_THET8 (P29253) Ribonuclease H (EC 3.1.26.4) (RNase H)| Length = 166 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = +1 Query: 136 AITPNR---HILDGGTGRPPLQRVSAEARR 216 A+ P+R H + G TG P +RV EARR Sbjct: 115 AMAPHRVRFHFVKGHTGHPENERVDREARR 144
>RNH_THET2 (Q72IE1) Ribonuclease H (EC 3.1.26.4) (RNase H)| Length = 166 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = +1 Query: 136 AITPNR---HILDGGTGRPPLQRVSAEARR 216 A+ P+R H + G TG P +RV EARR Sbjct: 115 AMAPHRVRFHFVKGHTGHPENERVDREARR 144
>RL4_TREPA (O83220) 50S ribosomal protein L4| Length = 216 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 118 HKRIATAITPNRHILDGGTGRPPLQRVSAEARRSD 222 +KR+ TA T R + G +P Q+ + ARR D Sbjct: 42 NKRLGTACTKGRSEVHGSNTKPYKQKGTGRARRGD 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,839,474 Number of Sequences: 219361 Number of extensions: 588126 Number of successful extensions: 1677 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1677 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)