| Clone Name | rbast71c02 |
|---|---|
| Clone Library Name | barley_pub |
>O52A1_HUMAN (Q9UKL2) Olfactory receptor 52A1 (HPFH1OR) (Odorant receptor| HOR3'beta4) Length = 312 Score = 29.6 bits (65), Expect = 3.0 Identities = 18/33 (54%), Positives = 19/33 (57%) Frame = +2 Query: 170 RFGSHGAPISHFLTH*PSCFSLITYFLLPPFLN 268 RFGSH P H L FS I Y L+PPFLN Sbjct: 266 RFGSHIPPYIHIL------FSSI-YLLVPPFLN 291
>SYFB_BORPE (Q7VVR5) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 49 FVSLVTSKLPYKRSMRRKMVPCRIIPLWYGSAQPARPQLNTI 174 F +L +LP R + R+ V R + LW + PA+ L+T+ Sbjct: 688 FEALAERRLPAVRKLSRQPVVVRDLALWVDAKLPAQAMLDTV 729
>HSP11_HELAN (P30693) 17.6 kDa class I heat shock protein| Length = 153 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 210 VRKCEIGAPCEPNRVELWSGWLCRSVPQRNNATWHHFP-SHGPFVREF 70 ++K E+ E RV SG CR ++++ TWH S G F+R F Sbjct: 65 MKKEEVKVEVEDGRVLQISGERCREQEEKDD-TWHRVERSSGKFIRRF 111
>SYFB_BORPA (Q7W7C6) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 49 FVSLVTSKLPYKRSMRRKMVPCRIIPLWYGSAQPARPQLNTI 174 F +L +LP R + R+ R + LW + PA+ L+T+ Sbjct: 688 FEALAERRLPAVRELSRQPAVVRDLALWVDAKLPAQAMLDTV 729
>SYFB_BORBR (Q7WKR4) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 805 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 49 FVSLVTSKLPYKRSMRRKMVPCRIIPLWYGSAQPARPQLNTI 174 F +L +LP R + R+ R + LW + PA+ L+T+ Sbjct: 688 FEALAERRLPAVRELSRQPAVVRDLALWVDAKLPAQAMLDTV 729 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,038,669 Number of Sequences: 219361 Number of extensions: 1084620 Number of successful extensions: 2000 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2000 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)