| Clone Name | rbast71a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VA0E_SCHPO (Q69Z14) Vacuolar ATP synthase subunit e (EC 3.6.3.14... | 29 | 3.5 | 2 | GLUQ_PROMM (Q7TUT1) Glutamyl-Q tRNA(Asp) synthetase (EC 6.1.1.-)... | 28 | 7.7 | 3 | PFA5_SCHPO (Q9C0W9) Palmitoyltransferase PFA5 (EC 2.3.1.-) (Prot... | 28 | 7.7 |
|---|
>VA0E_SCHPO (Q69Z14) Vacuolar ATP synthase subunit e (EC 3.6.3.14) (V-ATPase e| subunit) (Vacuolar proton pump e subunit) Length = 67 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 201 NTTVLWKWCLVLGYVLVFDRARMCVYLLWLLQSTARMHACKCSRKVL 61 N T W+ L+L + C YLLW + A++H + +VL Sbjct: 28 NNTSTWQMSLILTF--------SCCYLLWAITYLAQLHPLEAPSRVL 66
>GLUQ_PROMM (Q7TUT1) Glutamyl-Q tRNA(Asp) synthetase (EC 6.1.1.-) (Glu-Q-RSs)| Length = 306 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -1 Query: 156 LVFDRARMCVYLLWL--LQSTARMHACKCSRKVLA 58 +VF R +Y +L L+ +++AC+CSR++LA Sbjct: 95 VVFQSRRRGIYNSFLSALRRQGKLYACRCSRRMLA 129
>PFA5_SCHPO (Q9C0W9) Palmitoyltransferase PFA5 (EC 2.3.1.-) (Protein fatty| acyltransferase 5) Length = 312 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 5/58 (8%) Frame = -2 Query: 200 ILRFCGNGVSYWGTY*CLIER-----ECVYTYFGFCNRLHGCMLVSAPEKC*LASCSL 42 I F +G++Y+ + L +YTY+GF N + C AP C C L Sbjct: 65 IFFFITSGLAYFSYFRVLFSSPSFCGNTLYTYYGFDNPIFLCGPNGAPRMCGTCKCWL 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,611,589 Number of Sequences: 219361 Number of extensions: 731069 Number of successful extensions: 1500 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1500 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)