| Clone Name | rbast70c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YHJ5_YEAST (P38769) Hypothetical 72.3 kDa protein in SLT2-PUT2 i... | 28 | 6.9 | 2 | REPS_STRAM (P36891) Replication initiator protein | 27 | 9.0 | 3 | SWR1_KLULA (Q6CJ38) Helicase SWR1 (EC 3.6.1.-) | 27 | 9.0 |
|---|
>YHJ5_YEAST (P38769) Hypothetical 72.3 kDa protein in SLT2-PUT2 intergenic| region Length = 630 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 326 VLPFRATSPRTRVVFFSSFYNTRTDDMSSLCGPVI 222 +L R TSP R +F N D SLC P I Sbjct: 478 ILSVRNTSPDERYLFLHRIINASKDTCLSLCKPFI 512
>REPS_STRAM (P36891) Replication initiator protein| Length = 459 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 286 TTRVRGDVARNGSTARLAAPPCPADSYGTLAD 381 TTR+R ++A +R P C SYG +A+ Sbjct: 182 TTRLRREIAARAGLSRRELPDCLRVSYGKVAE 213
>SWR1_KLULA (Q6CJ38) Helicase SWR1 (EC 3.6.1.-)| Length = 1572 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 98 LIRQLFTAWALKLLIELECARRNSSGTWKTF 6 L +LF W L+E + RN+S ++KTF Sbjct: 20 LTNELFHLWEFTSLVEYDPLFRNTSNSFKTF 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,326,126 Number of Sequences: 219361 Number of extensions: 471914 Number of successful extensions: 1108 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1108 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)