| Clone Name | rbast69e05 |
|---|---|
| Clone Library Name | barley_pub |
>MTH7_DROME (Q9VSE7) Probable G-protein coupled receptor Mth-like 7 precursor| (Protein methuselah-like 7) Length = 491 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 123 CYCTFRECLRVCDPHRSWSWREELSRGLKD 212 C C+ R C+R+C P +++ + GLK+ Sbjct: 80 CVCSVRPCIRICCPAKNFLANGKCDDGLKE 109
>TARA_HUMAN (Q9H2D6) TRIO and F-actin-binding protein (Protein Tara)| (Trio-associated repeat on actin) Length = 2365 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 105 GSTELQCYCTFRECLRVCDPHRSWSW 182 G++ QC CT +E LR PHRS W Sbjct: 865 GTSSSQC-CTQKENLRPSSPHRSTQW 889
>TSC10_NEUCR (Q7RZR2) 3-ketodihydrosphingosine reductase tsc-10 (EC 1.1.1.102)| (3-dehydrosphinganine reductase) (KDS reductase) Length = 969 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/64 (26%), Positives = 28/64 (43%) Frame = -3 Query: 313 LQRSGGERVTSSTDEQDQGALERRAPRQEDVVVESFKPRLNSSLQLQDRCGSHTLKHSRN 134 LQ+ ++ +Q Q +P Q+ V P+L + LQLQ + HS + Sbjct: 464 LQQQQQQQQHQQHQQQQQNLATNLSPDQDPNHVNQIHPQLQAQLQLQHQQAQEHDLHSHH 523 Query: 133 VQ*H 122 +Q H Sbjct: 524 LQQH 527
>SIN3A_MOUSE (Q60520) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1282 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -3 Query: 334 WAKEFFNLQRSGGERVTSSTDEQDQGALERRAPRQEDVVVE--SFKPRLNSSLQL 176 + KE N + +GG + T+++ + R QED++ E F P NSS+ L Sbjct: 335 YQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLL 389
>SIN3A_HUMAN (Q96ST3) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1273 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -3 Query: 334 WAKEFFNLQRSGGERVTSSTDEQDQGALERRAPRQEDVVVE--SFKPRLNSSLQL 176 + KE N + +GG + T+++ + R QED++ E F P NSS+ L Sbjct: 335 YQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLL 389
>Y1812_THETN (Q8R918) Hypothetical RNA methyltransferase TTE1812 (EC 2.1.1.-)| Length = 452 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -3 Query: 298 GERVTSSTDEQDQGALERRAPRQEDVVVESFKPRLNSSLQLQDRCGSHTLKH 143 GERV +E + L+ + ++E + R+N Q DRCG +L+H Sbjct: 40 GERVIVEIEEVHKNYLKGYTVK----ILEKSQHRVNPLCQYADRCGGCSLQH 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,769,601 Number of Sequences: 219361 Number of extensions: 471117 Number of successful extensions: 1562 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1562 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)