| Clone Name | rbast69d10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRIA_TREPA (O83258) Primosomal protein N' (EC 3.6.1.-) (ATP-depe... | 27 | 9.5 | 2 | NTRK2_CHICK (Q91987) BDNF/NT-3 growth factors receptor precursor... | 27 | 9.5 | 3 | CFC1_MOUSE (P97766) Cryptic protein precursor | 27 | 9.5 |
|---|
>PRIA_TREPA (O83258) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 657 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = -3 Query: 209 YSFPCCACAVPSMWR---GAMNCAAC 141 Y+ C CAVP W GAM C C Sbjct: 371 YTLCCTQCAVPLTWHKRVGAMQCHYC 396
>NTRK2_CHICK (Q91987) BDNF/NT-3 growth factors receptor precursor (EC 2.7.10.1)| (Neurotrophic tyrosine kinase receptor type 2) (TrkB tyrosine kinase) (Trk-B) Length = 818 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 188 CAVPSMWRGAMNCAACYHYS*WR 120 C V WRGA+ C A S WR Sbjct: 20 CLVLGCWRGALGCPASCRCSSWR 42
>CFC1_MOUSE (P97766) Cryptic protein precursor| Length = 202 Score = 27.3 bits (59), Expect = 9.5 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Frame = +2 Query: 116 DCATNYSGSMQRNSWRLATC--SAPH--KHNTGNYTLLE*LVSSYDDVRHEPQCTVHSLL 283 DC G+ +S RL C SA + H T ++ L+ +SS R +C++ SLL Sbjct: 130 DCGALGHGAWTLHSCRLCRCIFSALYCLPHQTFSHCDLKSFLSS--GARGSRECSIPSLL 187 Query: 284 LAVIC 298 L V+C Sbjct: 188 LLVLC 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,739,614 Number of Sequences: 219361 Number of extensions: 638965 Number of successful extensions: 1422 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1422 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)