| Clone Name | rbast69d07 |
|---|---|
| Clone Library Name | barley_pub |
>RL26A_ARATH (P51414) 60S ribosomal protein L26-1| Length = 146 Score = 48.5 bits (114), Expect = 6e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ERITREKVNG+TVNVGI PSKV++T Sbjct: 81 IERITREKVNGTTVNVGIQPSKVVIT 106
>RL26_BRARA (Q39411) 60S ribosomal protein L26| Length = 146 Score = 46.2 bits (108), Expect = 3e-05 Identities = 18/26 (69%), Positives = 25/26 (96%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+TREKVNG+TVNVG+ P+KV++T Sbjct: 81 IERLTREKVNGTTVNVGVQPTKVVIT 106
>RL26_MOUSE (P61255) 60S ribosomal protein L26 (Silica-induced gene 20 protein)| (SIG-20) Length = 145 Score = 45.4 bits (106), Expect = 5e-05 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+ REK NG+TV+VGIHPSKV++T Sbjct: 82 IERVQREKANGTTVHVGIHPSKVVIT 107
>RL26_MACFA (P61256) 60S ribosomal protein L26| Length = 145 Score = 45.4 bits (106), Expect = 5e-05 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+ REK NG+TV+VGIHPSKV++T Sbjct: 82 IERVQREKANGTTVHVGIHPSKVVIT 107
>RL26_HUMAN (P61254) 60S ribosomal protein L26| Length = 145 Score = 45.4 bits (106), Expect = 5e-05 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+ REK NG+TV+VGIHPSKV++T Sbjct: 82 IERVQREKANGTTVHVGIHPSKVVIT 107
>RL26_BOVIN (P61257) 60S ribosomal protein L26| Length = 145 Score = 45.4 bits (106), Expect = 5e-05 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+ REK NG+TV+VGIHPSKV++T Sbjct: 82 IERVQREKANGTTVHVGIHPSKVVIT 107
>RL26L_HUMAN (Q9UNX3) 60S ribosomal protein L26-like 1| Length = 145 Score = 45.4 bits (106), Expect = 5e-05 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+ REK NG+TV+VGIHPSKV++T Sbjct: 82 IERVQREKANGTTVHVGIHPSKVVIT 107
>RL26_CHICK (P47832) 60S ribosomal protein L26 (Fragment)| Length = 128 Score = 45.4 bits (106), Expect = 5e-05 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+ REK NG+TV+VGIHPSKV++T Sbjct: 65 IERVQREKANGTTVHVGIHPSKVVIT 90
>RL26_CAEEL (Q19869) 60S ribosomal protein L26| Length = 142 Score = 45.1 bits (105), Expect = 7e-05 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +++ITREK NGSTV++GIHPSKV +T Sbjct: 81 IDKITREKANGSTVHIGIHPSKVAIT 106
>RL26B_ARATH (Q9FJX2) 60S ribosomal protein L26-2| Length = 146 Score = 43.9 bits (102), Expect = 2e-04 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ERITREKVNGSTVNVG++ S V++T Sbjct: 81 IERITREKVNGSTVNVGVNASNVMIT 106
>RL26_RAT (P12749) 60S ribosomal protein L26| Length = 145 Score = 42.4 bits (98), Expect = 5e-04 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+ REK NG+TV+VGI PSKV++T Sbjct: 82 IERVQREKANGTTVHVGIRPSKVVIT 107
>RL26_LITLI (Q95WA0) 60S ribosomal protein L26| Length = 144 Score = 42.4 bits (98), Expect = 5e-04 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIV 353 +ERI REK NG+TV VGIHPSKV++ Sbjct: 82 IERIQREKANGATVYVGIHPSKVLI 106
>RL26B_YEAST (P53221) 60S ribosomal protein L26-B (YL33)| Length = 126 Score = 38.9 bits (89), Expect = 0.005 Identities = 13/26 (50%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 V+++T+EKVNG++V + +HPSK+++T Sbjct: 81 VDKVTKEKVNGASVPINLHPSKLVIT 106
>RL26A_YEAST (P05743) 60S ribosomal protein L26-A (YL33)| Length = 126 Score = 38.9 bits (89), Expect = 0.005 Identities = 13/26 (50%), Positives = 24/26 (92%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 V+++T+EKVNG++V + +HPSK+++T Sbjct: 81 VDKVTKEKVNGASVPINLHPSKLVIT 106
>RL26_SCHPO (P78946) 60S ribosomal protein L26| Length = 126 Score = 37.0 bits (84), Expect = 0.019 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +ER+TREK NG++ VGI SKV++T Sbjct: 81 IERVTREKANGASAPVGIDASKVVIT 106
>MODC_AGRT5 (Q8UCD5) Molybdenum import ATP-binding protein modC (EC 3.6.3.29)| Length = 358 Score = 35.4 bits (80), Expect = 0.056 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 263 GELALGLVSSAATSLAVEEGLAVLVQLELGDDHLAGVDADVDRGSIHLLPGDPLH 427 G AL ++ T ++ E V +Q++ G D + D+ R +HL PG P+H Sbjct: 293 GLSALNILEGHVTGISESEDGMVTIQMDCGGDIIQSRITDLSRERLHLEPGKPVH 347
>RL24_SULSO (Q9UX95) 50S ribosomal protein L24P| Length = 119 Score = 33.1 bits (74), Expect = 0.28 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +E ITR+KV+G+ V V IH SKV++T Sbjct: 76 IEGITRKKVDGTPVYVWIHASKVMIT 101
>RL24_SULAC (O05633) 50S ribosomal protein L24P| Length = 134 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +E +T++K +G+ V V +H SKVI+T Sbjct: 76 IEGLTKKKADGTPVYVWVHASKVIIT 101
>PEX6_HUMAN (Q13608) Peroxisome assembly factor 2 (PAF-2) (Peroxisomal-type| ATPase 1) (Peroxin-6) (Peroxisomal biogenesis factor 6) Length = 980 Score = 29.3 bits (64), Expect = 4.0 Identities = 31/82 (37%), Positives = 35/82 (42%), Gaps = 3/82 (3%) Frame = +2 Query: 185 QPSL--INLLEXXXXXXXXTSCGGDVLGGELALGLVSSAATSLAVEEGLAVLVQLELG-D 355 QP L + +LE G LG LA GL AT LA G L EL Sbjct: 236 QPHLARVQVLEPRWDLSDRLGPGSGPLGEPLADGLALVPAT-LAFNLGCDPLEMGELRIQ 294 Query: 356 DHLAGVDADVDRGSIHLLPGDP 421 +L G A D+GS LLPG P Sbjct: 295 RYLEGSIAPEDKGSCSLLPGPP 316
>RL24_SULTO (Q975J1) 50S ribosomal protein L24P| Length = 137 Score = 29.3 bits (64), Expect = 4.0 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIVT 350 +E +TR+K +G+ V IH SKVI+T Sbjct: 78 IEGLTRKKADGTPVYRWIHASKVIIT 103
>RL24_PYRHO (O59429) 50S ribosomal protein L24P| Length = 121 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 427 VERITREKVNGSTVNVGIHPSKVIV 353 VE +T KVNG+ V IHPS V++ Sbjct: 78 VEGVTLRKVNGTEVFYPIHPSNVMI 102
>DPO1_STRR6 (P59200) DNA polymerase I (EC 2.7.7.7) (POL I)| Length = 877 Score = 28.5 bits (62), Expect = 6.9 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 28 SKSRAQAHDRCTLKVPKRSSTDILRIIKQQFSDSI 132 +K Q HD L+VPK ++ +++KQ ++I Sbjct: 823 TKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAI 857
>DPO1_STRPN (P59199) DNA polymerase I (EC 2.7.7.7) (POL I)| Length = 877 Score = 28.5 bits (62), Expect = 6.9 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 28 SKSRAQAHDRCTLKVPKRSSTDILRIIKQQFSDSI 132 +K Q HD L+VPK ++ +++KQ ++I Sbjct: 823 TKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEAI 857
>CCD22_HUMAN (O60826) Coiled-coil domain-containing protein 22| Length = 627 Score = 28.5 bits (62), Expect = 6.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 425 GADHQGEGEWIHGQRRHPPQQGDR 354 G D G+ +W+H R PPQ+ R Sbjct: 219 GRDRPGDEDWVHRTSRLPPQEDTR 242
>LPXD_PSESM (Q886N3) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase| (EC 2.3.1.-) Length = 351 Score = 28.1 bits (61), Expect = 9.0 Identities = 22/81 (27%), Positives = 33/81 (40%) Frame = +2 Query: 158 KTRIARAVWQPSLINLLEXXXXXXXXTSCGGDVLGGELALGLVSSAATSLAVEEGLAVLV 337 ++ I W + L G VLGGE G V+ V + A + Sbjct: 146 RSEIGEGGWLAPRVTLYHDVRIGKRVVIQSGAVLGGE-GFGFVNDKG----VWQKFAQIG 200 Query: 338 QLELGDDHLAGVDADVDRGSI 400 + LGDD GV+ +DRG++ Sbjct: 201 GVTLGDDVEIGVNTAIDRGAL 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,073,054 Number of Sequences: 219361 Number of extensions: 714490 Number of successful extensions: 1915 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1915 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)