| Clone Name | rbast65f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCAM_TRYCR (O76240) S-adenosylmethionine decarboxylase proenzyme... | 30 | 2.1 | 2 | CSKP_RAT (Q62915) Peripheral plasma membrane protein CASK (EC 2.... | 29 | 2.7 | 3 | NU153_RAT (P49791) Nuclear pore complex protein Nup153 (Nucleopo... | 29 | 3.5 | 4 | GLYM_ASHGO (Q758F0) Serine hydroxymethyltransferase, mitochondri... | 28 | 7.9 |
|---|
>DCAM_TRYCR (O76240) S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50)| (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine decarboxylase alpha chain; S-adenosylmethionine decarboxylase beta chain] Length = 370 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 262 SNIDSLASQFQSVGLEGTYYPREALLTRSATSVSIGY 152 S++ L + Q+VG+E YYP+ L R+ + GY Sbjct: 310 SDVGRLYQKGQNVGVEAEYYPKYELQNRTVNEFAPGY 346
>CSKP_RAT (Q62915) Peripheral plasma membrane protein CASK (EC 2.7.11.1)| (Calcium/calmodulin-dependent serine protein kinase) Length = 909 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = -3 Query: 161 YRLSSTYLQRTTQQWQWTHFWAADREKFTQERYLLIHNKDMPSF 30 +R++ +++T Q+ Q + W ++K +++YL HN D+ ++ Sbjct: 668 WRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNADLVTY 711
>NU153_RAT (P49791) Nuclear pore complex protein Nup153 (Nucleoporin Nup153)| (153 kDa nucleoporin) Length = 1468 Score = 28.9 bits (63), Expect = 3.5 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = -1 Query: 232 QSVGLEGTYYPREALLTRSATSVSIGYQA---PTFRGLHSNGSGPIFGQQTERSLLRSDT 62 QS G P ++ S S G Q PTF + S+ P+FGQQ +S S T Sbjct: 1322 QSQGASQPNPPSFGSISSSTALFSAGSQPVPPPTFGTVSSSSQPPVFGQQPSQSAFGSGT 1381
>GLYM_ASHGO (Q758F0) Serine hydroxymethyltransferase, mitochondrial precursor| (EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT) Length = 497 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 156 AIKHLPSEDYTAMAVDPFLGSRPREVYSGAIPFDTQQRY 40 +I +PSE++T++AV LGS + YS P QRY Sbjct: 61 SITLIPSENFTSVAVMNLLGSEMQNKYSEGYP---GQRY 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,749,626 Number of Sequences: 219361 Number of extensions: 588292 Number of successful extensions: 1583 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1583 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)