>ZP4_RABIT (Q00193) Zona pellucida sperm-binding protein 4 precursor (Zona|
           pellucida sperm-binding protein B) (Zona pellucida
           glycoprotein ZP-X) (RC55)
          Length = 540

 Score = 29.3 bits (64), Expect = 2.6
 Identities = 17/66 (25%), Positives = 25/66 (37%)
 Frame = +1

Query: 16  GPIFGRRNGHKCLPFGNQTYRKKLHVTQRNKTSTNNLTNQILNISYAGLSLA*HNSSRDD 195
           GPI+   +   C P G Q+      +  R + S  N  N   NIS  G  +    +    
Sbjct: 440 GPIYLHCSVSVCQPTGTQSCTVTCPIDSRRRNSDINFQNSTANISSKGPMILLQATEDPS 499

Query: 196 SNIHPH 213
             +H H
Sbjct: 500 EKLHKH 505


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,303,580
Number of Sequences: 219361
Number of extensions: 935815
Number of successful extensions: 2131
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2104
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2131
length of database: 80,573,946
effective HSP length: 85
effective length of database: 61,928,261
effective search space used: 1486278264
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)