| Clone Name | rbast64a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y946_ARCFU (O29316) Hypothetical protein AF0946 precursor | 32 | 0.33 | 2 | EAD_EBV (P03191) Early antigen protein D (EA-D) | 28 | 6.3 | 3 | TAB2_RAT (Q5U303) Mitogen-activated protein kinase kinase kinase... | 28 | 6.3 |
|---|
>Y946_ARCFU (O29316) Hypothetical protein AF0946 precursor| Length = 1036 Score = 32.3 bits (72), Expect = 0.33 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 208 EPTDRLTPLWKEPDDVLATKTVVSLSDETTTETML 104 +P L P++K DDVL KT+ L TT T++ Sbjct: 942 DPASELAPMYKADDDVLVIKTIELLETAPTTTTVV 976
>EAD_EBV (P03191) Early antigen protein D (EA-D)| Length = 404 Score = 28.1 bits (61), Expect = 6.3 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -1 Query: 250 LTKQSSHAVMPLPSEPTDRLTPLWKEP-DDVLATKTVVSLSDETTTETMLCYQ 95 L ++ H V P PS P TP W+ P + + S S T E L Q Sbjct: 324 LQQRPRHTVSPSPSPPPPPRTPTWESPARPETPSPAIPSHSSNTALERPLAVQ 376
>TAB2_RAT (Q5U303) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 2 Length = 693 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -1 Query: 229 AVMPLPSEPTDRLTPLWKEPDDVLATKTVVSLSDET 122 AV P PT LT L PD + T+T+ L+D T Sbjct: 475 AVSPGVVSPTFELTNLLNHPDHYVETETIQHLTDPT 510 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,465,113 Number of Sequences: 219361 Number of extensions: 359668 Number of successful extensions: 968 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)