| Clone Name | rbast63b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SFRS6_HUMAN (Q13247) Splicing factor, arginine/serine-rich 6 (Pr... | 32 | 0.78 | 2 | Y10K_MSVS (P14992) Hypothetical 10.9 kDa protein | 29 | 5.0 | 3 | ZDHC8_MOUSE (Q5Y5T5) Probable palmitoyltransferase ZDHHC8 (EC 2.... | 28 | 8.6 |
|---|
>SFRS6_HUMAN (Q13247) Splicing factor, arginine/serine-rich 6 (Pre-mRNA-splicing| factor SRP55) Length = 344 Score = 31.6 bits (70), Expect = 0.78 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +1 Query: 40 DHRKVSRCRRNSSFNSPIIT*LNRPPLRYRQTE*PPNLIGAKERHRYRETSLDQARSES 216 D + SR R S NSP+ PP + R PP ++ R R R S ++RS S Sbjct: 288 DIKSKSRSRSQSRSNSPLPV----PPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSS 342
>Y10K_MSVS (P14992) Hypothetical 10.9 kDa protein| Length = 101 Score = 28.9 bits (63), Expect = 5.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 190 SSPGTGGAPWLR*GWEVILSVDILMAVYLVRL 95 ++P +GG PW R G ILS L+ YL+ L Sbjct: 16 AAPTSGGVPWSRVGEVAILSFVALICFYLLYL 47
>ZDHC8_MOUSE (Q5Y5T5) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) Length = 762 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 132 DRMTSQPHRSQGAPPVP 182 D MT QP RS+G PP P Sbjct: 442 DHMTLQPLRSEGGPPTP 458 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,500,344 Number of Sequences: 219361 Number of extensions: 699997 Number of successful extensions: 1655 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1655 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)