| Clone Name | rbast62f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ABCG8_HUMAN (Q9H221) ATP-binding cassette sub-family G member 8 ... | 28 | 9.2 |
|---|
>ABCG8_HUMAN (Q9H221) ATP-binding cassette sub-family G member 8 (Sterolin-2)| Length = 673 Score = 27.7 bits (60), Expect = 9.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 Query: 131 LNPAM*NLLVSWIAPGCVRVLAIKKALLLGFFYNKRSYSGQL 6 L P + + L+ W+ C R++A+ A LL F+ +S L Sbjct: 525 LQPFLLHFLLVWLVVFCCRIMALAAAALLPTFHMASFFSNAL 566 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,419,713 Number of Sequences: 219361 Number of extensions: 311028 Number of successful extensions: 851 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 80,573,946 effective HSP length: 20 effective length of database: 76,186,726 effective search space used: 1828481424 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)