| Clone Name | rbast61g02 |
|---|---|
| Clone Library Name | barley_pub |
>OR6N1_HUMAN (Q8NGY5) Olfactory receptor 6N1| Length = 312 Score = 29.3 bits (64), Expect = 2.3 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 378 IGCILGDFAGPVVAILIFEKLQF 310 IGC LG AGPVV I + +L F Sbjct: 146 IGCWLGGLAGPVVEISLISRLPF 168
>LCAP_RAT (P97629) Leucyl-cystinyl aminopeptidase (EC 3.4.11.3) (Cystinyl| aminopeptidase) (Oxytocinase) (OTase) (Insulin-regulated membrane aminopeptidase) (Insulin-responsive aminopeptidase) (IRAP) (Placental leucine aminopeptidase) (P-LAP) (Vesicle prot Length = 1025 Score = 28.9 bits (63), Expect = 3.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 337 YPYFREVTVPARRVKTTISRYTVKKPRSSNLASSLPGF 224 YPY ++ V A T YT+K S+N+++S GF Sbjct: 237 YPYHEQIAVVAPESLLTGHNYTLKIEYSANISNSYYGF 274
>KCNQ3_BOVIN (P58126) Potassium voltage-gated channel subfamily KQT member 3| (Voltage-gated potassium channel subunit Kv7.3) (Potassium channel alpha subunit KvLQT3) (KQT-like 3) Length = 866 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 382 VDWLYPWRFCRTSCCYPYFR-EVTVPARRVKT-TISRYTVKKPRSSNLASSL 233 +D + WRF + +P+FR E PA K + R + PR SN L Sbjct: 393 IDLVATWRFYESVVSFPFFRKEQLDPAASQKLGLLDRVRLSNPRGSNTKGKL 444
>MKL1_HUMAN (Q969V6) MKL/myocardin-like protein 1 (Myocardin-related| transcription factor A) (MRTF-A) (Megakaryoblastic leukemia 1 protein) (Megacaryocytic acute leukemia protein) Length = 931 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 207 STSCSSKPGRLDARLDDLGFLTV*REMVVFTL-LAGTVT 320 STS + KPG L A LDD+ + +E+ + +L ++GT T Sbjct: 333 STSLTGKPGALPANLDDMKVAELKQELKLRSLPVSGTKT 371
>KCNQ3_HUMAN (O43525) Potassium voltage-gated channel subfamily KQT member 3| (Voltage-gated potassium channel subunit Kv7.3) (Potassium channel alpha subunit KvLQT3) (KQT-like 3) Length = 872 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 382 VDWLYPWRFCRTSCCYPYFREVTVPARRVKT--TISRYTVKKPRSSNLASSL 233 +D + WRF + +P+FR+ + A + + R + PR SN L Sbjct: 393 IDLVATWRFYESVVSFPFFRKEQLEAASSQKLGLLDRVRLSNPRGSNTKGKL 444
>POT2_ARATH (O22881) Potassium transporter 2 (AtPOT2) (AtKUP2) (AtKT2)| Length = 794 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = +2 Query: 212 FMFFKTRQARRKVG*PGFLNCVAGDGGLYPSSGNCNFSKIRIATT 346 FMF + + + G L C+ G ++ G+ N++ I+IA T Sbjct: 258 FMFLRKTRVSGWMSLGGILLCITGAEAMFADLGHFNYAAIQIAFT 302
>TAF4_HUMAN (O00268) Transcription initiation factor TFIID subunit 4| (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) (TAFII-130) (TAFII130) Length = 1085 Score = 27.3 bits (59), Expect = 8.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 291 PPSPATQLRNPGHP 250 PP+PAT R PGHP Sbjct: 274 PPAPATLARPPGHP 287
>KCNQ3_RAT (O88944) Potassium voltage-gated channel subfamily KQT member 3| (Voltage-gated potassium channel subunit Kv7.3) (Potassium channel alpha subunit KvLQT3) (KQT-like 3) Length = 873 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 382 VDWLYPWRFCRTSCCYPYFR--EVTVPARRVKTTISRYTVKKPRSSNLASSL 233 +D + WRF + +P+FR ++ A + + R + PR SN L Sbjct: 394 LDLVATWRFYESVVSFPFFRKEQLEAAASQKLGLLDRVRLSNPRGSNTKGKL 445
>KCNQ3_MOUSE (Q8K3F6) Potassium voltage-gated channel subfamily KQT member 3| (Voltage-gated potassium channel subunit Kv7.3) (Potassium channel alpha subunit KvLQT3) (KQT-like 3) Length = 873 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 382 VDWLYPWRFCRTSCCYPYFR--EVTVPARRVKTTISRYTVKKPRSSNLASSL 233 +D + WRF + +P+FR ++ A + + R + PR SN L Sbjct: 394 LDLVATWRFYESVVSFPFFRKEQLEAAASQKLGLLDRVRLSNPRGSNTKGKL 445 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,027,081 Number of Sequences: 219361 Number of extensions: 1161896 Number of successful extensions: 2350 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2349 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)