| Clone Name | rbast59e11 |
|---|---|
| Clone Library Name | barley_pub |
>TMOC_PSEME (Q00458) Toluene-4-monooxygenase system protein C| Length = 111 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -3 Query: 229 ECILISSEKGNSSSDMIVLRNPHEEDTHTHDLYASGVVCCAANKWWW-PYVDEGISTPNL 53 E ++++SE+ + + PH+E + Y GV+ C A+ W + GI+ + Sbjct: 26 EVLIVNSEEHGVKAYQAMC--PHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDC 83 Query: 52 CIVLYSV 32 C+ Y V Sbjct: 84 CLAEYPV 90
>CXA9_RAT (O70610) Gap junction alpha-9 protein (Connexin-36) (Cx36)| Length = 321 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 94 WWPYVDEGISTPNLCIVLYSVHQT 23 +W + + TP+LC + YSVHQ+ Sbjct: 78 YWVFQIIMVCTPSLCFITYSVHQS 101
>CXA9_MOUSE (O54851) Gap junction alpha-9 protein (Connexin-36) (Cx36)| Length = 321 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 94 WWPYVDEGISTPNLCIVLYSVHQT 23 +W + + TP+LC + YSVHQ+ Sbjct: 78 YWVFQIIMVCTPSLCFITYSVHQS 101
>CXA9_HUMAN (Q9UKL4) Gap junction alpha-9 protein (Connexin-36) (Cx36)| Length = 321 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 94 WWPYVDEGISTPNLCIVLYSVHQT 23 +W + + TP+LC + YSVHQ+ Sbjct: 78 YWVFQIIMVCTPSLCFITYSVHQS 101
>CXA9_BOVIN (Q866T7) Gap junction alpha-9 protein (Connexin-36) (Cx36)| Length = 321 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 94 WWPYVDEGISTPNLCIVLYSVHQT 23 +W + + TP+LC + YSVHQ+ Sbjct: 78 YWVFQIIMVCTPSLCFITYSVHQS 101
>DNBI_HHV7J (P52339) Major DNA-binding protein (MDBP)| Length = 1131 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 7/57 (12%) Frame = +2 Query: 5 HVMVIDGLM------YTVQYYTQIWRGNSFINIRPPPLICST-AHHTGCIEIMGVRI 154 H+M++D ++ YT +Y I+ N +N P+I S H +E+ +R+ Sbjct: 280 HLMLVDAVITELTFSYTAEYLDSIYENNQIMNFSEWPIIKSAETHEEKIVELKKLRL 336
>CXA9_RAJOC (P69999) Gap junction alpha-9 protein (Connexin-35) (Cx35)| Length = 302 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 94 WWPYVDEGISTPNLCIVLYSVHQT 23 +W + + TP+LC + YSVHQ+ Sbjct: 78 YWVFQIIMVCTPSLCFITYSVHQS 101
>CXA9_RAJER (P69998) Gap junction alpha-9 protein (Connexin-35) (Cx35)| Length = 302 Score = 28.5 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 94 WWPYVDEGISTPNLCIVLYSVHQT 23 +W + + TP+LC + YSVHQ+ Sbjct: 78 YWVFQIIMVCTPSLCFITYSVHQS 101
>KPB2_FUGRU (Q9W6R1) Phosphorylase b kinase alpha regulatory chain, liver| isoform (Phosphorylase kinase alpha L subunit) Length = 1229 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 36 LYNTIHKFGVEIPSST*GHHHLFAAQHTTPD 128 L++T K +P G HH+F+A+HTT D Sbjct: 673 LHSTTQK--CHLPPIQRGQHHVFSAEHTTRD 701
>NU4M_LUMTE (Q34949) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 452 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -3 Query: 202 GNSSSDMIVLRNPHEEDTHTHDLYASG---VVCCAANKWWWPYVDEGISTP 59 G SSS + V+ N + E THT L+ V+ WW+ + ++ P Sbjct: 314 GLSSSALFVMANMNYELTHTRSLFLMKGLLVLAPTLTMWWFLFTASNMAAP 364
>Y1238_THEVO (Q979C3) UPF0343 protein TV1238| Length = 284 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 196 SSSDMIVLRNPHEEDTHTHDLYAS 125 S DM+++ + EE H H+ YAS Sbjct: 247 SDDDMVIVSSDSEESIHPHNAYAS 270
>YPL1_CAEEL (Q9U3G6) Protein yippee-like F37A8.5| Length = 137 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 28 DVHCTILYTNLAWKFLHQHKATTTY 102 D++C I T L WK+ H +++ Y Sbjct: 89 DIYCEICKTTLGWKYEHAFESSQKY 113
>P3C2G_MOUSE (O70167) Phosphatidylinositol-4-phosphate 3-kinase C2| domain-containing gamma polypeptide (EC 2.7.1.154) (Phosphoinositide 3-Kinase-C2-gamma) (PtdIns-3-kinase C2 gamma) (PI3K-C2gamma) Length = 1506 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 62 RGNSFINIRPPPLICSTAH-HTGCIEIMGVRIFFMWISEHNHI 187 R FI + P + + H H+G I + W S+HNH+ Sbjct: 1023 RAQGFIEMVPDAVTLAKIHLHSGLIGPLKENTIKKWFSQHNHL 1065 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,394,987 Number of Sequences: 219361 Number of extensions: 827908 Number of successful extensions: 1974 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1973 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)