| Clone Name | rbast58g12 |
|---|---|
| Clone Library Name | barley_pub |
>YSI1_CAEEL (Q10033) Hypothetical protein F15G9.1| Length = 279 Score = 29.3 bits (64), Expect = 2.7 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 239 PEALPEKQAHGLPSPTKSSDLFKSGQT*MGLPKE 138 P L K+ G+P P KSSD+ K G LPK+ Sbjct: 203 PTVLNAKKLGGIPWPPKSSDVKKEGGDAEALPKK 236
>TRUC_PECCC (Q47417) tRNA pseudouridine synthase C (EC 5.4.99.-) (tRNA-uridine| isomerase C) (tRNA pseudouridylate synthase C) Length = 376 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -3 Query: 277 GGEERPRRWSCASQKPFLRNKPMVSLAQQKALTCLSRARHKWAFPK 140 G ++RPRR+ C S + PM +AQ L + + H A K Sbjct: 85 GRQKRPRRFCCVSSSSMSYSPPMYRMAQCTMLEIIYQDEHLVAVNK 130
>MG42_TARMA (P40651) SRY-related protein MG42 (Fragment)| Length = 72 Score = 28.5 bits (62), Expect = 4.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 163 WPDLNKSELFVGLGRPW 213 WPD++ +E+ LGRPW Sbjct: 23 WPDMHNAEISKRLGRPW 39
>KIF1A_HUMAN (Q12756) Kinesin-like protein KIF1A (Axonal transporter of synaptic| vesicles) Length = 1690 Score = 28.1 bits (61), Expect = 6.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 242 EPEALPEKQAHGLPSPTKSSDLFKSGQ 162 EPE LPE + LPSP ++++ K Q Sbjct: 1534 EPELLPEADSKKLPSPARATETDKEPQ 1560
>PRP4B_MOUSE (Q61136) Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1)| (PRP4 pre-mRNA-processing factor 4 homolog) (Pre-mRNA protein kinase) Length = 1007 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 108 RFLTLRSFRYFFGKAHLCL 164 +F LR FR+F+ K HLCL Sbjct: 747 KFHCLRLFRHFYHKQHLCL 765
>PRP4B_HUMAN (Q13523) Serine/threonine-protein kinase PRP4 homolog (EC 2.7.11.1)| (PRP4 pre-mRNA-processing factor 4 homolog) (PRP4 kinase) Length = 1007 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 108 RFLTLRSFRYFFGKAHLCL 164 +F LR FR+F+ K HLCL Sbjct: 747 KFHCLRLFRHFYHKQHLCL 765 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,517,587 Number of Sequences: 219361 Number of extensions: 808341 Number of successful extensions: 2046 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2044 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)