| Clone Name | rbast58b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VGL2_EBV (P03218) Probable membrane glycoprotein | 28 | 5.3 | 2 | TPSD3_ABIGR (O24475) Pinene synthase, chloroplast precursor (EC ... | 28 | 9.0 |
|---|
>VGL2_EBV (P03218) Probable membrane glycoprotein| Length = 248 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 137 WRRGFTWFYLPQRWVTCAFVLPVVSLYVVS 48 WR TW + +TCA V PV+ + ++S Sbjct: 201 WRPKTTWVHWALLLITCAVVAPVLLIIIIS 230
>TPSD3_ABIGR (O24475) Pinene synthase, chloroplast precursor (EC 4.2.3.14)| (Beta-geraniolene synthase) ((-)-(1S,5S)-pinene synthase) (Agg-pin1) Length = 628 Score = 27.7 bits (60), Expect = 9.0 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +3 Query: 6 KKTVHSSVISKALITYNIQGDYGKDESTSDPSLGQVKPGKSTTPTLNTSGT 158 K +H S+IS T+ + K S + P+LG + GKS TP+++ S T Sbjct: 12 KSCLHKSLISS---THEL-----KALSRTIPALGMSRRGKSITPSISMSST 54 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,765,671 Number of Sequences: 219361 Number of extensions: 250708 Number of successful extensions: 1144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1144 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)