| Clone Name | rbast57c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1594_HAEIN (P44265) Hypothetical protein HI1594 | 28 | 4.5 | 2 | YEHS_ECOLI (P33355) Hypothetical protein yehS | 28 | 7.6 | 3 | PRR1_SCHPO (O14283) Transcription factor prr1 (Pombe response re... | 27 | 9.9 |
|---|
>Y1594_HAEIN (P44265) Hypothetical protein HI1594| Length = 223 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -1 Query: 241 VRPKDEEKNLAIMSSL*HIIGVTETSPAVAIERLYE 134 V+P E +N++I S H+I ++ +P V+I+ YE Sbjct: 126 VKPSLEAENISIGKSSSHLINISGLNPEVSIKSEYE 161
>YEHS_ECOLI (P33355) Hypothetical protein yehS| Length = 156 Score = 27.7 bits (60), Expect = 7.6 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 9/59 (15%) Frame = -1 Query: 292 LLPRAAMDVFTEEIAVWVRPKDEE-----KNLAIMSSL*HII----GVTETSPAVAIER 143 +L ++ E+IAVW+R +DEE ++ + S L +I G E++PA+ ER Sbjct: 24 ILALGNVEATAEQIAVWLRKEDEEGFQRCPDIVLSSFLNGLIYEKRGKDESAPALEPER 82
>PRR1_SCHPO (O14283) Transcription factor prr1 (Pombe response regulator 1)| Length = 539 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 195 SELIMAKFFSSSLGLTHTAISSVNTSIAALGSSIDTTG 308 S MAK FS + SSV TS++ +G+++ TTG Sbjct: 325 SNASMAKSFSQISNDSLAKASSVATSMSQMGAAVPTTG 362 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,164,975 Number of Sequences: 219361 Number of extensions: 650915 Number of successful extensions: 1356 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1356 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)