| Clone Name | rbast57a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.2... | 42 | 5e-04 | 2 | Y115_ADE02 (P03290) Hypothetical protein E-115 | 33 | 0.25 | 3 | DPOL_HBVA4 (Q05486) P protein [Includes: DNA-directed DNA polyme... | 30 | 2.7 | 4 | BAR1_SCHCO (Q92275) Pheromone B alpha 1 receptor | 29 | 6.0 |
|---|
>SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.21.-)| (Cucumisin-like serine protease) Length = 757 Score = 42.4 bits (98), Expect = 5e-04 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -2 Query: 447 KPSGTNGFGRLVWSSDHHVVASPILATWT 361 KPSG+N FG + WS HVV SP+ +WT Sbjct: 729 KPSGSNSFGSIEWSDGKHVVGSPVAISWT 757
>Y115_ADE02 (P03290) Hypothetical protein E-115| Length = 115 Score = 33.5 bits (75), Expect = 0.25 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = -3 Query: 446 SRRAPTGSAGS-SGPATTTWWPARSWRRGP 360 +RRA TGSA + +GPA++ WPARS R P Sbjct: 84 TRRAKTGSASAPAGPASSAPWPARSPERTP 113
>DPOL_HBVA4 (Q05486) P protein [Includes: DNA-directed DNA polymerase (EC| 2.7.7.7); RNA-directed DNA polymerase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 843 Score = 30.0 bits (66), Expect = 2.7 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +2 Query: 95 LHSPCFRNPNKSMPS*HTRCHNSLLAQAALASKRQQENETANQ*ITTPNRHTRT 256 +H+P R P PS TRC N+L +++A + E AN ++T RHT T Sbjct: 247 VHTPT-RWPAGVEPS-STRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTST 298
>BAR1_SCHCO (Q92275) Pheromone B alpha 1 receptor| Length = 639 Score = 28.9 bits (63), Expect = 6.0 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 6/63 (9%) Frame = -2 Query: 429 GFGRL------VWSSDHHVVASPILATWT*PPRPAVGAVLISNAVEGKNAAGQQWRRRSR 268 GFGR+ VW S H +V L W P + A E + WRR R Sbjct: 248 GFGRIDQVPAIVWRSQHLIVVCNELTRWCAPVSAFIFFFYFGFAEEARRNYAAAWRRVCR 307 Query: 267 SDG 259 + G Sbjct: 308 ALG 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,043,693 Number of Sequences: 219361 Number of extensions: 1314239 Number of successful extensions: 3648 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3643 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)