| Clone Name | rbast56d03 |
|---|---|
| Clone Library Name | barley_pub |
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 137 CSCKLVCVDVCLWCACSKDLLVSVRLCCLCTR 42 C C++ C CL C C K CC C++ Sbjct: 620 CCCRVCCRACCLLCGCPK--------CCRCSK 643
>NPT2B_PONPY (Q5REV9) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 689 Score = 29.3 bits (64), Expect = 2.3 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 137 CSCKLVCVDVCLWCACSKDLLVSVRLCCLCTR 42 C C++ C CL C C K CC C++ Sbjct: 619 CCCRVCCRACCLLCGCPK--------CCRCSK 642
>NPT2B_BOVIN (Q27960) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 693 Score = 28.9 bits (63), Expect = 3.0 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 137 CSCKLVCVDVCLWCACSKDLLVSVRLCCLCTR 42 C C++ C C C CSK CC CT+ Sbjct: 619 CCCRVCCRLCCGLCGCSK--------CCRCTK 642
>CE290_BOVIN (Q9TU23) Centrosomal protein Cep290| Length = 1453 Score = 28.1 bits (61), Expect = 5.2 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 110 HQHILACKNTGLAAFARTHSISRLTRYVQAYTLR 211 HQH+++ + + AA + S++ + V+A+TLR Sbjct: 283 HQHVVSLQASEAAALGKVESVASKLQKVEAHTLR 316
>VE5_HPV70 (P50774) Probable protein E5| Length = 78 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 125 LVCVDVCLWCACSKDLLVSVRLCCLCTRVVFM 30 LV VCL+ CS LL SV LC ++F+ Sbjct: 14 LVWFAVCLYICCSVPLLPSVHLCAYMWLLLFV 45
>HSP1_NATST (Q8WNZ3) Sperm protamine P1| Length = 49 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 271 TRSRSPCTAPRRRCTTEPSMTKRIRLHVPS*SAYTVCSCKR 149 ++SRS C RRRC T R R YTV C+R Sbjct: 8 SQSRSRCRPRRRRCRTRRRRCCRRRRRRVCCRRYTVVRCRR 48
>HSP1_NATMI (Q8WNZ4) Sperm protamine P1| Length = 49 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -3 Query: 271 TRSRSPCTAPRRRCTTEPSMTKRIRLHVPS*SAYTVCSCKR 149 ++SRS C RRRC T R R YTV C+R Sbjct: 8 SQSRSRCRRRRRRCRTRRRRCCRRRRRRVCCRRYTVVRCRR 48
>RPGR_MOUSE (Q9R0X5) X-linked retinitis pigmentosa GTPase regulator (mRpgr)| Length = 1001 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 161 THSISRLTRYVQAYTLRHARLSGAPPPRRG 250 T ++ R TR+ + L+H LSG P + G Sbjct: 745 TENVFRATRFFPKFDLKHDHLSGIPEEQEG 774
>HSP1_MURCY (Q8WNY7) Sperm protamine P1| Length = 47 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 268 RSRSPCTAPRRRCTTEPSMTKRIRLHVPS*SAYTVCSCKR 149 RSRS C RRRC R R YTV C+R Sbjct: 7 RSRSRCRRRRRRCHRRRRRCSRRRRRRVCCRRYTVIRCRR 46
>K1219_MOUSE (Q8BQZ4) Protein KIAA1219| Length = 1484 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 28 SINTTRVHRQHSRTLTSRSFEQAHHKHTSTHTSLQEHRAS 147 ++NTT H + R +T T+ HTS +H+AS Sbjct: 375 AVNTTPPHNRRHRAVTVNKATMKTSTVTTAHTSKVQHQAS 414
>SYFB_DESPS (Q6ANC2) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 816 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +1 Query: 1 GEQIRLSFYSINTTRVHRQHSRTLTSRSFEQAHHKHTSTHT 123 G +I+ + S+ + +R ++TLT ++ E++H K S T Sbjct: 766 GGKIQKGYKSVAVSITYRSQTKTLTEKNVEKSHSKIVSLLT 806
>E316_ADE03 (P11320) Early E3 16 kDa glycoprotein| Length = 146 Score = 27.3 bits (59), Expect = 8.8 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = -3 Query: 142 PCVLAS*YVLMCVYGVLVRKTYWSVYGCVVYAPVLCLWNKKTGGF 8 P V+A L V G LV + C Y +LC W KK G + Sbjct: 102 PWVVAGFVTLGVVAGGLVLILCYLYTPCCAYLVILCCWFKKWGPY 146
>CR015_HUMAN (Q96N68) Protein C18orf15| Length = 181 Score = 27.3 bits (59), Expect = 8.8 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = -2 Query: 152 TQLALCSCKLVCVDVCLW---CACSKDLLVSVRLC-CLCTR 42 T + +C+C VCV VC C C V V +C C C R Sbjct: 125 TVVCMCACMCVCVHVCACVYVCMC-----VLVCMCACACMR 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,873,704 Number of Sequences: 219361 Number of extensions: 737799 Number of successful extensions: 2106 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2104 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)