| Clone Name | rbast56c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MCSP_HUMAN (P49901) Sperm mitochondrial-associated cysteine-rich... | 30 | 1.1 | 2 | KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-as... | 30 | 1.8 | 3 | GUN9_ARATH (Q9C9H5) Probable family 9 endoglucanase At1g71380 pr... | 27 | 8.9 |
|---|
>MCSP_HUMAN (P49901) Sperm mitochondrial-associated cysteine-rich protein| Length = 116 Score = 30.4 bits (67), Expect = 1.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 343 SRCSCPLMQSHCCLPTPPIC 284 S+C CP +HCC P PP C Sbjct: 48 SQC-CPPKHNHCCQPKPPCC 66
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/57 (28%), Positives = 21/57 (36%) Frame = +1 Query: 181 SALSCICMRHQAPCC*ALFAFVGAAAEEAWPPADCISVALGGSSETA*EGSCSAKLC 351 S+L C Q CC + + G P C+ V G SS + SC C Sbjct: 294 SSLCCQQSSCQPACCTSSQSQQGCCVPVCCKPVSCVPVCSGASSSCCQQSSCQPACC 350
>GUN9_ARATH (Q9C9H5) Probable family 9 endoglucanase At1g71380 precursor (EC| 3.2.1.4) Length = 484 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 404 PAAAAQMQGFSMQVPSLPHNFALQLPSHAV 315 P + M GFS P H+ A LPSHA+ Sbjct: 384 PIKMSYMVGFSSNFPKRIHHRASSLPSHAL 413 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,418,025 Number of Sequences: 219361 Number of extensions: 846094 Number of successful extensions: 2201 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2200 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)