| Clone Name | rbast55g09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UNG_BUCBP (P59465) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG) | 28 | 4.3 | 2 | YM59_YEAST (Q03648) Hypothetical 52.2 kDa protein in RAR1-SCJ1 i... | 28 | 4.3 | 3 | SYBL1_PONPY (Q5RF94) Synaptobrevin-like protein 1 | 28 | 4.3 | 4 | SYBL1_HUMAN (P51809) Synaptobrevin-like protein 1 (Tetanus insen... | 28 | 4.3 | 5 | MAO1_SHEON (Q8EAP2) NAD-dependent malic enzyme (EC 1.1.1.38) (NA... | 28 | 5.6 |
|---|
>UNG_BUCBP (P59465) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 224 Score = 28.5 bits (62), Expect = 4.3 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 158 LTPWSSIVIDESLKICHFVGLITLLLYHMQ-RMVFGPKADVCYLFM 24 L WSSI+ +E K +F+ +I L + Q +M+F PK V F+ Sbjct: 6 LLNWSSILKNEKKKY-YFINIINHLFFERQKKMIFPPKGKVFNAFV 50
>YM59_YEAST (Q03648) Hypothetical 52.2 kDa protein in RAR1-SCJ1 intergenic| region Length = 457 Score = 28.5 bits (62), Expect = 4.3 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 234 DYDKIVFCLLHVCETISNLAKRMALTHTLELHC 136 DYDKI+ C + +T N+ + ++ L+ +C Sbjct: 349 DYDKIIICSAYFIDTAENMFEYLSSIEALKKYC 381
>SYBL1_PONPY (Q5RF94) Synaptobrevin-like protein 1| Length = 219 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 190 CFTNMKQTENYLVIIIIEAS*LIYVNINPLCSSF 291 C N+K T +IIII + IY+ ++PLC F Sbjct: 182 CMKNLKLT----IIIIIVSIVFIYIIVSPLCGGF 211
>SYBL1_HUMAN (P51809) Synaptobrevin-like protein 1 (Tetanus insensitive VAMP)| (Ti-VAMP) (Ti-VAMP/VAMP7) Length = 219 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 190 CFTNMKQTENYLVIIIIEAS*LIYVNINPLCSSF 291 C N+K T +IIII + IY+ ++PLC F Sbjct: 182 CMKNLKLT----IIIIIVSIVFIYIIVSPLCGGF 211
>MAO1_SHEON (Q8EAP2) NAD-dependent malic enzyme (EC 1.1.1.38) (NAD-ME)| Length = 562 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -1 Query: 258 DELRSFNDDYDKIVFCLLHVCETISNLAKRMALTHTLEL 142 D+ RSFN+D DK ++ L ++ +T L R+ H E+ Sbjct: 59 DQFRSFNNDLDKHIY-LRNIQDTNETLFYRLVQNHISEM 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,891,240 Number of Sequences: 219361 Number of extensions: 835028 Number of successful extensions: 2079 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2079 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)