| Clone Name | rbast52b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADH2_CAEEL (O45687) Probable alcohol dehydrogenase K12G11.4 (EC ... | 28 | 5.4 | 2 | YTNL_BACSU (O34980) Hypothetical protein ytnL | 28 | 7.1 | 3 | CN132_HUMAN (Q9NPU4) Protein C14orf132 | 27 | 9.2 |
|---|
>ADH2_CAEEL (O45687) Probable alcohol dehydrogenase K12G11.4 (EC 1.1.1.1)| Length = 351 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +1 Query: 163 RKKGKLVFVWLPKFSTIYL--LSTICKTL 243 RK+G +VFV LPK TI L LS IC + Sbjct: 263 RKRGTVVFVGLPKDGTIPLDTLSLICNEI 291
>YTNL_BACSU (O34980) Hypothetical protein ytnL| Length = 416 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +1 Query: 112 NLPYIQNLKGTSPTKTERKKGKLVFVWLPKFSTIYLLSTICKTLGSCSLHVHHSPSMEKR 291 +L Y +N++G+ P +T + L + S LST+ K L H+H P + K Sbjct: 2 SLDYWRNIEGSYPYQTTGND----ILTLKEESNPVNLSTLEKQLIGIRRHLHQYPELSKE 57 Query: 292 SYE 300 +E Sbjct: 58 EFE 60
>CN132_HUMAN (Q9NPU4) Protein C14orf132| Length = 173 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +1 Query: 190 WLPK-FSTIYLLSTI----CKTLGSCSLHVHHSPSM 282 W PK S + LLS + CKT G+ L HH PS+ Sbjct: 93 WRPKRLSGVCLLSALLPDPCKTNGTFLLQKHHLPSL 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,719,014 Number of Sequences: 219361 Number of extensions: 979315 Number of successful extensions: 2547 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2547 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)