| Clone Name | rbast50g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y825_PASMU (Q9CMJ9) UPF0227 protein PM0825 | 30 | 1.4 | 2 | O51V1_HUMAN (Q9H2C8) Olfactory receptor 51V1 (Odorant receptor H... | 29 | 3.0 | 3 | SC7_SCHCO (P35794) Fruiting body protein SC7 precursor | 28 | 4.0 | 4 | PK1_NPVHZ (P41719) Serine/threonine-protein kinase 1 (EC 2.7.11.1) | 28 | 4.0 | 5 | LPPB_HAESO (P36685) Outer membrane antigenic lipoprotein B precu... | 27 | 8.9 |
|---|
>Y825_PASMU (Q9CMJ9) UPF0227 protein PM0825| Length = 179 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 Query: 290 HDSSFVLHGVHYLVAASLNPPPAAAIVGYG 379 HD F+L+ VH LV+ S +P P VG G Sbjct: 41 HDMQFLLNEVHKLVSESKDPAPLICGVGLG 70
>O51V1_HUMAN (Q9H2C8) Olfactory receptor 51V1 (Odorant receptor HOR3'beta1)| (Olfactory receptor OR11-36) Length = 321 Score = 28.9 bits (63), Expect = 3.0 Identities = 20/48 (41%), Positives = 23/48 (47%) Frame = -1 Query: 166 ICMRIIGESFQFLKKHKISVPLIIFSLCHSSSAGHSFNLLSGDLRSAC 23 I + IIG SF F+ I L F+ CH HSF L LR AC Sbjct: 153 IGLTIIGRSFFFITPPIIC--LKFFNYCHFHILSHSFCLHQDLLRLAC 198
>SC7_SCHCO (P35794) Fruiting body protein SC7 precursor| Length = 204 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +2 Query: 158 HADEP--TTAQYSAASHWDWVDFPQSGSATCTAHS 256 +A+EP T YS A HW V + + S C A+S Sbjct: 127 NAEEPDYNTTTYSGAGHWTQVVWKSTTSVGCAAYS 161
>PK1_NPVHZ (P41719) Serine/threonine-protein kinase 1 (EC 2.7.11.1)| Length = 267 Score = 28.5 bits (62), Expect = 4.0 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = -1 Query: 148 GESFQFLKKHK----ISVPLIIFSLCHSSSAGHSFNLLSGDLR 32 G+ F FLKKHK I+ L + +A HS+ ++ DL+ Sbjct: 94 GDLFDFLKKHKKVSEAETRSIVGQLTEALNALHSYKIIHNDLK 136
>LPPB_HAESO (P36685) Outer membrane antigenic lipoprotein B precursor| (Fragment) Length = 337 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 89 TENNQWHRNLVFFEKLKRLAYNTHADEPTTAQYSAASHWDWVDFPQSG 232 T N W+ N E++K +A TH+ P A S+ W+ +P +G Sbjct: 186 TVNETWNANKPTNEQMKPVATPTHSTMPINKTPPATSNIAWI-WPTNG 232 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,000,507 Number of Sequences: 219361 Number of extensions: 1067997 Number of successful extensions: 3127 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3127 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)