| Clone Name | rbast50e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WRKY8_ARATH (Q9FL26) Probable WRKY transcription factor 8 (WRKY ... | 29 | 3.2 | 2 | IF3X_HUMAN (O75153) Putative eukaryotic translation initiation f... | 28 | 4.2 | 3 | ACCD_SPIOL (Q9M3L7) Acetyl-coenzyme A carboxylase carboxyl trans... | 28 | 5.5 | 4 | NOP12_CANGA (Q6FUS6) Nucleolar protein 12 | 28 | 7.2 | 5 | PPAN_DROME (Q9VDE5) Protein Peter pan | 27 | 9.4 |
|---|
>WRKY8_ARATH (Q9FL26) Probable WRKY transcription factor 8 (WRKY DNA-binding| protein 8) Length = 326 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 6 GEHRGILSHLKPILTGGEKKENKNGHLTTKEEDQKKKQP 122 GE G + + + GGE + + TK++++KKK+P Sbjct: 131 GEDSGKIRKKREVRDGGEDDQRSQKVVKTKKKEEKKKEP 169
>IF3X_HUMAN (O75153) Putative eukaryotic translation initiation factor 3| subunit (eIF-3) Length = 1309 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 146 QIHAQHARTQLVSIDPSVSWTMNDPPSLNFL 238 +IH +H R L S+DPS ++ D SL+FL Sbjct: 129 RIHVRHVRDLLKSLDPSDAFNGVDCNSLSFL 159
>ACCD_SPIOL (Q9M3L7) Acetyl-coenzyme A carboxylase carboxyl transferase subunit| beta (EC 6.4.1.2) (ACCase beta chain) Length = 522 Score = 28.1 bits (61), Expect = 5.5 Identities = 17/64 (26%), Positives = 27/64 (42%) Frame = +2 Query: 41 HLNRGRKEREQKWTFNNKRRRSEEEAASKK***PIQIHAQHARTQLVSIDPSVSWTMNDP 220 H NRG++ +KW FN+ + E E H + S+ P + + + Sbjct: 23 HANRGQESSMKKWWFNSMLSKKELE------------HGCGLSKSMDSLGPIENTSTKED 70 Query: 221 PSLN 232 PSLN Sbjct: 71 PSLN 74
>NOP12_CANGA (Q6FUS6) Nucleolar protein 12| Length = 396 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 36 KPILTGGEKKENKNGHLTTKEEDQKKKQ 119 KP+L G+K+ +K G +T + + KK Q Sbjct: 366 KPVLKKGKKERSKTGRVTKRSQAFKKSQ 393
>PPAN_DROME (Q9VDE5) Protein Peter pan| Length = 460 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 27 SHLKPILTGGEKKENKNGHLTTKEEDQKKKQ 119 S +P L GG K +NK L TK+++ K ++ Sbjct: 384 SRKRPSLGGGMKYKNKRAKLDTKDKNDKSER 414 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,801,327 Number of Sequences: 219361 Number of extensions: 607219 Number of successful extensions: 1682 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1682 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)