| Clone Name | rbast50e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYFA_NITMU (Q2YBS2) Phenylalanyl-tRNA synthetase alpha chain (EC... | 30 | 1.8 | 2 | SRP1_SCHPO (Q10193) Pre-mRNA-splicing factor srp1 | 28 | 4.0 | 3 | TYCB_BREPA (O30408) Tyrocidine synthetase 2 (Tyrocidine syntheta... | 28 | 5.3 | 4 | VGLE_PRVRI (P08354) Glycoprotein GI precursor | 27 | 9.0 |
|---|
>SYFA_NITMU (Q2YBS2) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 344 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 149 PQAHEVTRMSNTFQVKEENNNLSPAYRRQHTVP 247 P++H M +TF V +EN S R HT P Sbjct: 146 PESHPARAMHDTFYVDDENGGASEHLLRTHTSP 178
>SRP1_SCHPO (Q10193) Pre-mRNA-splicing factor srp1| Length = 275 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 128 GTARVRRPQAHEVTRMSNTFQVKEENNNLSPAYRRQHTVPSGK 256 G R R P HE S + + ++SP YR + P G+ Sbjct: 111 GRLRSRSPSPHEARSRSPYNDERSDRRSMSPRYRSRSRSPDGR 153
>TYCB_BREPA (O30408) Tyrocidine synthetase 2 (Tyrocidine synthetase II)| [Includes: ATP-dependent proline adenylase (ProA) (Proline activase); ATP-dependent phenylalanine adenylase (PheA) (Phenylalanine activase); ATP-dependent D-phenylalanine adenylase (D Length = 3587 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 207 ITYHPLTGDNILSQAESELRFHLGERE 287 + Y P D+ L A+ +L FHL ERE Sbjct: 2448 LVYRPYESDSALDVAKFDLSFHLTERE 2474
>VGLE_PRVRI (P08354) Glycoprotein GI precursor| Length = 577 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 208 IVFFFHLKCIRHPCYFMCLWPPDSSSSFGSGHKIDLFSYKVFA 80 ++++ + CI HP CL P D + SF S + L + + +A Sbjct: 275 LLYYVYEPCIYHPRAPECLRPVDPACSFTSPARAALVARRAYA 317 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,623,268 Number of Sequences: 219361 Number of extensions: 707723 Number of successful extensions: 1280 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1280 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)