| Clone Name | rbast50a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SC11A_MOUSE (Q9R053) Sodium channel protein type 11 alpha subuni... | 28 | 4.5 | 2 | HEX3_ADEG1 (Q64754) Peripentonal hexon-associated protein (Prote... | 28 | 4.5 | 3 | DIG1_CAEEL (Q09165) Mesocentin precursor | 28 | 7.7 | 4 | CG021_HUMAN (Q9BVT8) Protein C7orf21 (SB144) | 28 | 7.7 | 5 | DMP1_MOUSE (O55188) Dentin matrix acidic phosphoprotein 1 precur... | 27 | 10.0 | 6 | LIMK1_XENLA (O42565) LIM domain kinase 1 (EC 2.7.11.1) (LIMK-1) ... | 27 | 10.0 |
|---|
>SC11A_MOUSE (Q9R053) Sodium channel protein type 11 alpha subunit (Sodium| channel protein type XI alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.9) (Sensory neuron sodium channel 2) (NaN) Length = 1765 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 180 SEMYIWTGLDGRPIGPNKRVSDDDICWN*TRAGPT 76 SEM ++TG G P+ P + DD C A PT Sbjct: 881 SEMTLYTGQAGAPLAPLAKEEDDMECCGECDASPT 915
>HEX3_ADEG1 (Q64754) Peripentonal hexon-associated protein (Protein IIIA)| Length = 575 Score = 28.5 bits (62), Expect = 4.5 Identities = 9/29 (31%), Positives = 21/29 (72%) Frame = +3 Query: 63 LHVNGSAQLVFNSNRYHHRRPVYSAQWDA 149 +++ GS+Q + +N + + +P++ A+WDA Sbjct: 182 INLGGSSQNINLTNAFENLKPIWGARWDA 210
>DIG1_CAEEL (Q09165) Mesocentin precursor| Length = 13100 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +1 Query: 124 PFIRPNGTPVQSSPYVHFGGTDQSHSHISQLGDRVLLDEAEQRDAGGP 267 P I P+GTP+ GTD + ++I+ +GD + E+ D G P Sbjct: 9574 PIINPDGTPL---------GTDSTGNYITSIGDII-----ERDDEGKP 9607 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +1 Query: 124 PFIRPNGTPVQSSPYVHFGGTDQSHSHISQLGDRVLLDEAEQRDAGGP 267 P I P+GTP+ GTD + ++I+ +GD + E+ D G P Sbjct: 7037 PIINPDGTPL---------GTDSTGNYITSIGDII-----ERDDEGKP 7070
>CG021_HUMAN (Q9BVT8) Protein C7orf21 (SB144)| Length = 246 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 118 GDPFIRPNGTPVQSSPYVHFGGTD 189 GDP +P+GTP S P TD Sbjct: 37 GDPLPQPSGTPTPSQPSAAMAATD 60
>DMP1_MOUSE (O55188) Dentin matrix acidic phosphoprotein 1 precursor (Dentin| matrix protein 1) (DMP-1) (AG1) Length = 503 Score = 27.3 bits (59), Expect = 10.0 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +1 Query: 103 TDIIIGDPFIRPNGTPVQSSPYVHFGGTDQSHSHISQLGDRVLLDEAEQRDAGG 264 TD + G P N + S + H+H S+ G+ + D + R AGG Sbjct: 34 TDDLAGSPPPPTNSESSEESQASPEAQANSDHTHSSESGEELGYDRGQYRPAGG 87
>LIMK1_XENLA (O42565) LIM domain kinase 1 (EC 2.7.11.1) (LIMK-1) (xLIMK1)| Length = 615 Score = 27.3 bits (59), Expect = 10.0 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 97 IPTDIIIGDPFIRPNGTPVQSSPYVHFGGTDQSHSHISQL 216 I + I IGD + NGTP++S P Q S + QL Sbjct: 202 IQSSIHIGDRILEINGTPIRSVPLDEIDVLIQETSRLLQL 241 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,129,960 Number of Sequences: 219361 Number of extensions: 789686 Number of successful extensions: 2158 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2079 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2158 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)