| Clone Name | rbast47g08 |
|---|---|
| Clone Library Name | barley_pub |
>PGIP1_ORYSA (Q8GT95) Polygalacturonase inhibitor 1 precursor| (Polygalacturonase-inhibiting protein) (Floral organ regulator 1) Length = 332 Score = 43.5 bits (101), Expect = 2e-04 Identities = 18/25 (72%), Positives = 19/25 (76%) Frame = -2 Query: 433 MRHGCKPYEHNLCHRGAPLESSCHQ 359 +RHGCKPYEHN C GAPL CHQ Sbjct: 308 IRHGCKPYEHNQCAGGAPL-GGCHQ 331
>TCB1_RABIT (P06333) T-cell receptor beta chain ANA 11| Length = 319 Score = 30.8 bits (68), Expect = 1.5 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Frame = +2 Query: 38 YMIHPDSRTRAHTHSLGEAHLQT-----VHTHTARTHL 136 Y++HP + HTH+ H+ +HTHT THL Sbjct: 55 YLLHPHTHVCTHTHTCTHTHIHASTHVCIHTHTF-THL 91
>WRN_MOUSE (O09053) Werner syndrome ATP-dependent helicase homolog (EC 3.6.1.-)| Length = 1401 Score = 30.8 bits (68), Expect = 1.5 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +2 Query: 62 TRAHTHSLGEAHLQTVHTHTARTHLYRLVVHKASSSQGPRLSGITTVPARYSTPL 226 T H+ + A L T ++ RTH Y++ +S + P+ S + P S+PL Sbjct: 1052 TTQHSSNQNPAGLTTKQSNLERTHSYKVPEKVSSGTNIPKKSAVMPSPGTSSSPL 1106
>DERM_HUMAN (Q07507) Dermatopontin precursor (Tyrosine-rich acidic matrix| protein) (TRAMP) Length = 201 Score = 29.6 bits (65), Expect = 3.3 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 228 YTKPQSTVLRSSYTRTYAHENANTDRHHSSYNVP-PSAGGEVAQSWWQLLSSGAPRWQRL 404 Y PQ V+ + R+ + +DR + +P P + GE + WW+ ++ W + Sbjct: 48 YQCPQGQVIVA--VRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQT 105 Query: 405 CS 410 CS Sbjct: 106 CS 107
>CRVP_OPHHA (Q7ZT98) Ophanin precursor (Opharin)| Length = 239 Score = 29.3 bits (64), Expect = 4.3 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +3 Query: 258 SSYTRTYAHENANTDRHHS-SYNVPPSAGGEVAQSWWQLLSSGAPRWQRLCS*GLHP 425 S TR + D H+S +V P+A + W+ +S A RW C+ G P Sbjct: 24 SESTRRQKKQKEIVDLHNSLRRSVSPTASNMLKMQWYPEAASNAERWASNCNLGHSP 80
>CRVP1_NAJAT (Q7T1K6) Natrin-1 precursor (Cysteine-rich venom protein 1)| (NA-CRVP1) (Protein G2a) Length = 239 Score = 28.9 bits (63), Expect = 5.7 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +3 Query: 258 SSYTRTYAHENANTDRHHS-SYNVPPSAGGEVAQSWWQLLSSGAPRWQRLCS 410 S TR + D H+S V P+A + W+ +S A RW CS Sbjct: 24 SESTRRKKKQKEIVDLHNSLRRRVSPTASNMLKMEWYPEAASNAERWANTCS 75
>RF2_THEMA (Q9X1R5) Peptide chain release factor 2 (RF-2)| Length = 369 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 288 NANTDRHHSSYNVPPSAGGEVAQSWWQLLSSGAPRW 395 N D +++ +V P AGG +Q W Q+L RW Sbjct: 119 NGKYDPNNAYLSVHPGAGGTESQDWAQMLLRMYMRW 154
>DERM_BOVIN (P19427) Dermatopontin (Tyrosine-rich acidic matrix protein)| (TRAMP) (22 kDa extracellular matrix protein) (Dermatan sulfate proteoglycan-associated protein 22K) Length = 183 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 270 RTYAHENANTDRHHSSYNVP-PSAGGEVAQSWWQLLSSGAPRWQRLCS 410 R+ ++ +DR + +P P + GE + WW+ ++ W + CS Sbjct: 42 RSIFNKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCS 89
>QUEF_AQUAE (O67073) 7-cyano-7-deazaguanine reductase (EC 1.7.1.-)| Length = 129 Score = 28.1 bits (61), Expect = 9.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 109 YRLEMRFPERVCVCPCSG 56 Y +E+ FPE C+CP SG Sbjct: 30 YMIEITFPEFTCLCPRSG 47
>VG_DROME (Q26366) Protein vestigial| Length = 453 Score = 28.1 bits (61), Expect = 9.7 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +2 Query: 56 SRTRAHTHSLGEAHLQT---VHTHTARTHLYRLVVHKASS 166 S R H HSL AH HTHT +T L+V ++ + Sbjct: 152 SSHRTHAHSLAHAHTHPHSHTHTHTHQTKEEDLIVPRSEA 191
>LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1607 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 146 PNDRDVCVLCVCVPSGDALPRESVCVPVFG 57 PN D C C C P G + ++S C PV G Sbjct: 873 PNPADKCKACACNPYG-TVQQQSSCNPVTG 901 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,766,374 Number of Sequences: 219361 Number of extensions: 1270142 Number of successful extensions: 3547 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3546 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)