| Clone Name | rbast47d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YL35_CAEEL (P34426) Hypothetical protein F44B9.5 | 30 | 3.0 | 2 | ARCA_BACLD (O86131) Arginine deiminase (EC 3.5.3.6) (ADI) (Argin... | 29 | 3.9 | 3 | HNF1B_PIG (Q03365) Hepatocyte nuclear factor 1-beta (HNF-1beta) ... | 28 | 8.8 |
|---|
>YL35_CAEEL (P34426) Hypothetical protein F44B9.5| Length = 390 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 165 CYLQCSRIISFHTLMVHCNILQLVFEKIG 79 C L+ S + HTL + C+IL +V EK G Sbjct: 61 CLLRKSAALRMHTLRIMCSILGIVVEKSG 89
>ARCA_BACLD (O86131) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 413 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -1 Query: 383 GASSCKCHECRHVSIPSYCVYDMNTCTVSLVSLGGGHQLESARSEW 246 G ++ + H ++P + V+L+ GGG ++ SAR +W Sbjct: 306 GKTADEIHTTEEHNLPEVLKRTLGLSDVNLIFCGGGDEIASAREQW 351
>HNF1B_PIG (Q03365) Hepatocyte nuclear factor 1-beta (HNF-1beta) (HNF-1B)| (Variant hepatic nuclear factor 1) (VHNF1) (FPC-binding protein) (FPCB) Length = 559 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 47 NNHMHTHELAPPIFSNTS 100 N+HM+TH+ PP +S+TS Sbjct: 511 NSHMYTHKQEPPQYSHTS 528 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,602,837 Number of Sequences: 219361 Number of extensions: 1094500 Number of successful extensions: 2397 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2397 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)