| Clone Name | rbast47a11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FBLN1_BRARE (O42182) Fibulin-1 precursor | 30 | 2.0 | 2 | DAPA_RALSO (Q8Y099) Dihydrodipicolinate synthase (EC 4.2.1.52) (... | 28 | 4.4 |
|---|
>FBLN1_BRARE (O42182) Fibulin-1 precursor| Length = 681 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +2 Query: 143 DHTKIITSSQACYKVNPL----HFCATSERCFSQMDT*NLSRRIDCSRLY 280 D K+ T + C +N H C T ERC + + + R I C Y Sbjct: 180 DGFKLKTDGKHCEDINECLLGPHHCVTGERCINTLGSYRCQREISCGTGY 229
>DAPA_RALSO (Q8Y099) Dihydrodipicolinate synthase (EC 4.2.1.52) (DHDPS)| Length = 294 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 238 YLKSIKKDRLL*IIPEISSPQQEVRRLHFR 327 Y KS+ D L ++P + P QE LHFR Sbjct: 93 YAKSVGADASLQVVPYYNKPTQEGMYLHFR 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,124,283 Number of Sequences: 219361 Number of extensions: 790915 Number of successful extensions: 1205 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)