| Clone Name | rbast42g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EID1_ARATH (Q8LEA8) Phytochrome A-associated F-box protein (Empf... | 86 | 3e-17 | 2 | DPOE1_HUMAN (Q07864) DNA polymerase epsilon, catalytic subunit A... | 30 | 1.1 | 3 | MURA_PHOLL (Q7N068) UDP-N-acetylglucosamine 1-carboxyvinyltransf... | 29 | 3.1 | 4 | THIO2_DICDI (P29446) Thioredoxin 2 (Fragment) | 27 | 9.0 |
|---|
>EID1_ARATH (Q8LEA8) Phytochrome A-associated F-box protein (Empfindlicher im| dunkelroten Licht protein 1) Length = 336 Score = 85.5 bits (210), Expect = 3e-17 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 389 EAWDLYSAFCLRSFHGYHDDGEPVVRAYVCENGHVAGAWTERPLYS 252 E WDL+S+FCLR G+HDDGEPVVRAYVCENGHV+GAWT PLY+ Sbjct: 291 ETWDLHSSFCLRRVFGFHDDGEPVVRAYVCENGHVSGAWTALPLYT 336
>DPOE1_HUMAN (Q07864) DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7)| (DNA polymerase II subunit A) Length = 2286 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 117 RDPHRGYVRAELIIRTCEACLAMDL 191 RDP R YV E+I R+C C +DL Sbjct: 2145 RDPCRSYVLPEVICRSCNFCRDLDL 2169
>MURA_PHOLL (Q7N068) UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC| 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) Length = 421 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 81 IHHSRMHDLGARRDPHRGYVRAELIIRTCEACLAMDLTMAERGVPVMSS 227 +H S + LGA GYV+A + R AC+ MD V +M++ Sbjct: 124 LHISGLEQLGAEIVLEEGYVKASVNGRLKGACIVMDKVSVGATVTIMTA 172
>THIO2_DICDI (P29446) Thioredoxin 2 (Fragment)| Length = 88 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 126 VDLGELRGHACVSDVSFLPCFFFIR 52 VD+ +L GH V ++ +P F+F R Sbjct: 56 VDIDKLSGHPIVKEIRSVPTFYFYR 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,872,487 Number of Sequences: 219361 Number of extensions: 727950 Number of successful extensions: 1825 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1825 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)