| Clone Name | rbast42f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule... | 39 | 0.002 | 2 | APG_ARATH (P40602) Anter-specific proline-rich protein APG precu... | 35 | 0.061 | 3 | FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51... | 32 | 0.52 | 4 | GUNX_CLOTM (P15329) Putative endoglucanase X (EC 3.2.1.4) (EGX) ... | 28 | 7.5 | 5 | ESC1_SCHPO (Q04635) Protein esc1 | 27 | 9.8 |
|---|
>EST_HEVBR (Q7Y1X1) Esterase precursor (EC 3.1.1.-) (Early nodule-specific| protein homolog) (Latex allergen Hev b 13) Length = 391 Score = 39.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = -2 Query: 296 CADPSAYANWDGVHLTEAAYHAIADSILHGPYTSPRLL*PPAC 168 CA PS NWDG H TEAA D I G ++ P + AC Sbjct: 337 CACPSVRVNWDGAHYTEAANEYFFDQISTGAFSDPPVPLNMAC 379
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 34.7 bits (78), Expect = 0.061 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 326 ANCGVRGSSVCADPSAYANWDGVHLTEAAYHAI 228 A C S +C + S+Y WDGVH T+ AY I Sbjct: 488 ALCKKSTSKICPNTSSYLFWDGVHPTQRAYKTI 520
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 31.6 bits (70), Expect = 0.52 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 296 CADPSAYANWDGVHLTEAAYHAIADSILHG 207 C +P WDGVH T+AA I D I G Sbjct: 335 CDEPDKAVVWDGVHFTQAANKFIFDKIAPG 364
>GUNX_CLOTM (P15329) Putative endoglucanase X (EC 3.2.1.4) (EGX)| (Endo-1,4-beta-glucanase) (Cellulase) (Fragment) Length = 224 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 314 VRGSSVCADPSAYANWDGVHLTEAAYHAIAD 222 V+ S + D + +WDG+HL+E Y IA+ Sbjct: 101 VKLSEIQFDRNTDISWDGLHLSEIGYTKIAN 131
>ESC1_SCHPO (Q04635) Protein esc1| Length = 413 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 35 GSTSLPPRSSLFCPVGRPQPLH 100 G T LPP + L P RPQP H Sbjct: 62 GQTRLPPINCLAEPFNRPQPWH 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,891,557 Number of Sequences: 219361 Number of extensions: 503249 Number of successful extensions: 1343 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)