ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast40e02 |
|---|---|
| Clone Library Name | barley_pub |
>IAP1_NPVOP (O10296) Apoptosis inhibitor 1 (IAP-1)| Length = 275 Score = 45.4 bits (106), Expect = 6e-05 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKV 311 RD + PCRH C+C +C AL KCP CRQ V ++I V Sbjct: 235 RDAVLLPCRHFCVCMQCYFAL---DGKCPTCRQDVADFIKIFV 274
>IAP1_NPVAC (P41435) Apoptosis inhibitor 1 (IAP-1)| Length = 286 Score = 43.5 bits (101), Expect = 2e-04 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKV 311 RD + PCRH C+C +C L KCP CRQ V ++I V Sbjct: 246 RDAVLMPCRHFCVCVQCYFGL---DQKCPTCRQDVTDFIKIFV 285
>NEURL_MOUSE (Q923S6) Neuralized-like protein 1 (m-neuralized 1) (m-neu1)| Length = 574 Score = 41.2 bits (95), Expect = 0.001 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLME 320 DT ++ C H+C+C C L+ + CPICR+P++ +++ Sbjct: 530 DTVIYTCGHMCLCYSCGLRLKKALHACCPICRRPIKDIIK 569
>RNGB_DICDI (Q7M3S9) Ring finger protein B (Protein rngB)| Length = 943 Score = 41.2 bits (95), Expect = 0.001 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 448 TEPRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 + P + + PCRH +CS+C L KCPICR +E + I Sbjct: 902 SNPPNIVLLPCRHSSLCSDCCSKL----TKCPICRSHIENKISI 941
>NEUL1_HUMAN (O76050) Neuralized-like protein 1 (h-neuralized 1) (h-neu) (RING| finger protein 67) Length = 574 Score = 40.8 bits (94), Expect = 0.002 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLME 320 DT ++ C H+C+C C L+ + CPICR+P++ +++ Sbjct: 530 DTVIYTCGHMCLCYACGLRLKKALHACCPICRRPIKDIIK 569
>IAP1_DROME (Q24306) Apoptosis 1 inhibitor (Inhibitor of apoptosis 1) (dIAP1)| (Protein thread) Length = 438 Score = 40.0 bits (92), Expect = 0.003 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 +TA PC H+ C++CA ++ KCP+CR+P +M + Sbjct: 400 NTAFLPCGHVVACAKCASSV----TKCPLCRKPFTDVMRV 435
>RNF26_HUMAN (Q9BY78) RING finger protein 26| Length = 433 Score = 38.5 bits (88), Expect = 0.008 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -3 Query: 445 EPRDTAVFPCRHLCMCSECAQALR---LQSNKCPICRQPVEKLMEI 317 + + + PCRHLC+C C + L + CP+CR+ + + + + Sbjct: 386 QSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRGILQTLNV 431
>BIRC2_MOUSE (Q62210) Baculoviral IAP repeat-containing protein 2 (Inhibitor of| apoptosis protein 2) (MIAP2) (MIAP-2) Length = 612 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL +C ECA +LR KCPICR ++ Sbjct: 579 PCGHLVVCQECAPSLR----KCPICRGTIK 604
>BIR_CHICK (Q90660) Inhibitor of apoptosis protein (IAP) (Inhibitor of T-cell| apoptosis protein) Length = 611 Score = 38.1 bits (87), Expect = 0.010 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL +C ECA +LR KCPICR ++ Sbjct: 578 PCGHLVVCKECAPSLR----KCPICRGTIK 603
>BIRC2_HUMAN (Q13490) Baculoviral IAP repeat-containing protein 2 (Inhibitor of| apoptosis protein 2) (HIAP2) (HIAP-2) (C-IAP1) (TNFR2-TRAF signaling complex protein 2) (IAP homolog B) Length = 618 Score = 37.7 bits (86), Expect = 0.013 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICR 344 PC HL +C ECA +LR KCPICR Sbjct: 585 PCGHLVVCQECAPSLR----KCPICR 606
>MDM2_MOUSE (P23804) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Oncoprotein Mdm2) (Double minute 2 protein) Length = 489 Score = 37.7 bits (86), Expect = 0.013 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 412 HLCMCSECAQALRLQSNKCPICRQPVEKLM 323 HL C CA+ L+ ++ CP+CRQP++ ++ Sbjct: 455 HLMSCFTCAKKLKKRNKPCPVCRQPIQMIV 484
>MDM2_HUMAN (Q00987) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Oncoprotein Mdm2) (Double minute 2 protein) (Hdm2) Length = 491 Score = 37.7 bits (86), Expect = 0.013 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 412 HLCMCSECAQALRLQSNKCPICRQPVEKLM 323 HL C CA+ L+ ++ CP+CRQP++ ++ Sbjct: 457 HLMACFTCAKKLKKRNKPCPVCRQPIQMIV 486
>MDM2_HORSE (P56951) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Double minute 2 protein) (Edm2) Length = 491 Score = 37.7 bits (86), Expect = 0.013 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 412 HLCMCSECAQALRLQSNKCPICRQPVEKLM 323 HL C CA+ L+ ++ CP+CRQP++ ++ Sbjct: 457 HLMACFTCAKKLKKRNKPCPVCRQPIQMIV 486
>MDM2_FELCA (Q7YRZ8) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Double minute 2 protein) Length = 491 Score = 37.7 bits (86), Expect = 0.013 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 412 HLCMCSECAQALRLQSNKCPICRQPVEKLM 323 HL C CA+ L+ ++ CP+CRQP++ ++ Sbjct: 457 HLMACFTCAKKLKKRNKPCPVCRQPIQMIV 486
>MDM2_CANFA (P56950) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Double minute 2 protein) (Cdm2) Length = 487 Score = 37.7 bits (86), Expect = 0.013 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -3 Query: 412 HLCMCSECAQALRLQSNKCPICRQPVEKLM 323 HL C CA+ L+ ++ CP+CRQP++ ++ Sbjct: 453 HLMACFTCAKKLKKRNKPCPVCRQPIQMIV 482
>BIRC3_HUMAN (Q13489) Baculoviral IAP repeat-containing protein 3 (Inhibitor of| apoptosis protein 1) (HIAP1) (HIAP-1) (C-IAP2) (TNFR2-TRAF signaling complex protein 1) (IAP homolog C) (Apoptosis inhibitor 2) (API2) Length = 604 Score = 37.7 bits (86), Expect = 0.013 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL +C +CA +LR KCPICR ++ Sbjct: 571 PCGHLVVCKDCAPSLR----KCPICRSTIK 596
>MDM2_XENLA (P56273) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Double minute 2 protein) (Xdm2) Length = 473 Score = 37.4 bits (85), Expect = 0.017 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = -3 Query: 448 TEPRDTAVFPCR--HLCMCSECAQALRLQSNKCPICRQPVEKLM 323 T P++ + R HL C CA+ L+ ++ CP+CR+P++ ++ Sbjct: 425 TRPKNGCIVHGRTGHLMACYTCAKKLKKRNKPCPVCREPIQMIV 468
>MDM2_MESAU (Q60524) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Oncoprotein Mdm2) (Double minute 2 protein) (Fragment) Length = 466 Score = 37.4 bits (85), Expect = 0.017 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -3 Query: 412 HLCMCSECAQALRLQSNKCPICRQPVEKL 326 HL C CA+ L+ ++ CP+CRQP++ + Sbjct: 438 HLMSCFPCAKKLKKRNKPCPVCRQPIQMI 466
>LRSM1_MOUSE (Q80ZI6) Ubiquitin ligase protein LRSAM1 (EC 6.3.2.-) (Leucine-rich| repeat and sterile alpha motif-containing protein 1) (Tsg101-associated ligase) Length = 727 Score = 37.4 bits (85), Expect = 0.017 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 418 CRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 C H+C C +C Q LR CP+CRQ + + + I Sbjct: 694 CGHVCCCQQCCQPLR----TCPLCRQEISQRLRI 723
>PIAP_PIG (O62640) Putative inhibitor of apoptosis| Length = 358 Score = 37.0 bits (84), Expect = 0.023 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL +C +CA +LR KCPICR ++ Sbjct: 325 PCGHLVVCKDCAPSLR----KCPICRGTIK 350
>MYLIP_BRARE (Q6TEM9) Ubiquitin ligase MYLIP (EC 6.3.2.-) (Myosin regulatory| light chain-interacting protein) (MIR) Length = 472 Score = 37.0 bits (84), Expect = 0.023 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -3 Query: 445 EPRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 E D A PC H+ C CA L+ CP+CR VE + + Sbjct: 390 EEIDAAFCPCGHMVCCQNCAAQLQ----SCPVCRSEVEHVQHV 428
>NEUR_DROME (P29503) Protein neuralized| Length = 754 Score = 37.0 bits (84), Expect = 0.023 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 442 PRDTAVFPCRHLCMCSECA--QALRLQSNKCPICRQPVEKLM 323 P D+ ++ C H+CMC +CA Q + +CP+CR + ++ Sbjct: 708 PIDSVLYMCGHMCMCYDCAIEQWRGVGGGQCPLCRAVIRDVI 749
>NEUR_DROVI (Q24746) Protein neuralized| Length = 747 Score = 37.0 bits (84), Expect = 0.023 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 442 PRDTAVFPCRHLCMCSECA--QALRLQSNKCPICRQPVEKLM 323 P D+ ++ C H+CMC +CA Q + +CP+CR + ++ Sbjct: 701 PIDSVLYMCGHMCMCYDCAIEQWRGVGGGQCPLCRAVIRDVI 742
>LRSM1_HUMAN (Q6UWE0) Ubiquitin ligase protein LRSAM1 (EC 6.3.2.-) (Leucine-rich| repeat and sterile alpha motif-containing protein 1) (Tsg101-associated ligase) (hTAL) Length = 723 Score = 37.0 bits (84), Expect = 0.023 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 418 CRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 C H+C C +C Q LR CP+CRQ + + + I Sbjct: 690 CGHVCCCQQCCQPLR----TCPLCRQDIAQRLRI 719
>BIRC3_MOUSE (O08863) Baculoviral IAP repeat-containing protein 3 (Inhibitor of| apoptosis protein 1) (MIAP1) (MIAP-1) Length = 600 Score = 37.0 bits (84), Expect = 0.023 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL +C +CA +LR KCPICR ++ Sbjct: 567 PCGHLVVCKDCAPSLR----KCPICRGTIK 592
>CGRF1_MOUSE (Q8BMJ7) Cell growth regulator with RING finger domain 1 (Cell| growth regulatory gene 19 protein) Length = 332 Score = 37.0 bits (84), Expect = 0.023 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEK 329 + PCRH C+C C + + +CP+CRQ V++ Sbjct: 286 LLPCRHACLCDSCVRYFK----QCPMCRQFVQE 314
>MDM2_BRARE (O42354) Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding| protein Mdm2) (Double minute 2 protein) Length = 445 Score = 35.8 bits (81), Expect = 0.050 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -3 Query: 412 HLCMCSECAQALRLQSNKCPICRQPVEKLM 323 HL C CA+ L+ ++ CP+CR+P++ ++ Sbjct: 411 HLMACYTCAKKLKNRNKLCPVCREPIQSVV 440
>CGRF1_HUMAN (Q99675) Cell growth regulator with RING finger domain 1 (Cell| growth regulatory gene 19 protein) Length = 332 Score = 35.8 bits (81), Expect = 0.050 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEK 329 + PCRH C+C C + + +CP+CRQ V++ Sbjct: 286 LLPCRHTCLCDGCVKYFQ----QCPMCRQFVQE 314
>RFFL_MOUSE (Q6ZQM0) Rififylin (RING finger and FYVE-like domain-containing| protein 1) (Fring) Length = 377 Score = 35.4 bits (80), Expect = 0.066 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 442 PRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 P D + C H+ C++C + + N+CPICRQ V + + + Sbjct: 337 PIDCVLLECGHMVTCTKCGKRM----NECPICRQYVIRAVHV 374
>BIRC7_HUMAN (Q96CA5) Baculoviral IAP repeat-containing protein 7 (Kidney| inhibitor of apoptosis protein) (KIAP) (Melanoma inhibitor of apoptosis protein) (ML-IAP) (Livin) Length = 298 Score = 35.4 bits (80), Expect = 0.066 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPV 335 PC HL +C+ECA L+L CPICR PV Sbjct: 266 PCGHL-VCAECAPGLQL----CPICRAPV 289
>RFFL_RAT (Q8CIN9) Rififylin (RING finger and FYVE-like domain-containing| protein 1) (FYVE-RING finger protein Sakura) Length = 362 Score = 35.4 bits (80), Expect = 0.066 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 442 PRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 P D + C H+ C++C + + N+CPICRQ V + + + Sbjct: 322 PIDCVLLECGHMVTCTKCGKRM----NECPICRQYVIRAVHV 359
>CGRF1_RAT (P97587) Cell growth regulator with RING finger domain 1 (Cell| growth regulatory gene 19 protein) Length = 332 Score = 35.4 bits (80), Expect = 0.066 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEK 329 + PCRH C+C C + +CP+CRQ V++ Sbjct: 286 LLPCRHACLCDSCVCYFK----QCPMCRQFVQE 314
>RFFL_HUMAN (Q8WZ73) Rififylin (RING finger and FYVE-like domain-containing| protein 1) (FYVE-RING finger protein Sakura) (Fring) (Caspases-8 and -10-associated RING finger protein 2) (CARP-2) (Caspase regulator CARP2) (RING finger protein 189) (RING finge Length = 363 Score = 35.4 bits (80), Expect = 0.066 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 442 PRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 P D + C H+ C++C + + N+CPICRQ V + + + Sbjct: 323 PIDCVLLECGHMVTCTKCGKRM----NECPICRQYVIRAVHV 360
>RN113_CAEEL (O17917) Putative RING finger protein 113 homolog| Length = 384 Score = 34.7 bits (78), Expect = 0.11 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLM 323 D V C+H C+ CA +S+KCPIC+Q E +M Sbjct: 250 DPIVTKCKHY-FCTGCALKSFQKSSKCPICQQNTENIM 286
>MIB2_RAT (Q68LP1) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (Mind bomb| homolog 2) (RBSC-skeletrophin/dystrophin-like polypeptide) Length = 971 Score = 34.3 bits (77), Expect = 0.15 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKV 311 VF C H C+ C AL N CPICRQP+ ++I V Sbjct: 938 VFQCGHGA-CAPCGAAL----NACPICRQPIRDRIQIFV 971
>VGLG_CHAV (P13180) Spike glycoprotein precursor| Length = 524 Score = 34.3 bits (77), Expect = 0.15 Identities = 26/73 (35%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +1 Query: 106 WVCP--ISATALQLYC-TIHIRHSPKTLPANQKQKETSGADQAPYTITSAFIHTSSTCGA 276 WV P + Q YC TIH +S +PA+Q +K G P T+T A+ T A Sbjct: 164 WVDPLFVGGECDQSYCDTIH--NSSVWIPADQTKKNICGQSFTPLTVTVAYDKTKE-IAA 220 Query: 277 SSIVFLMAQHSSL 315 IVF HS + Sbjct: 221 GGIVFKSKYHSHM 233
>IAP_GVCP (P41436) Apoptosis inhibitor IAP| Length = 275 Score = 34.3 bits (77), Expect = 0.15 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 PC H+ C++CA L +KCP+CR+ V ++++ Sbjct: 242 PCGHVVACAKCA----LSVDKCPMCRKIVTSVLKV 272
>MIB2_MOUSE (Q8R516) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (Mind bomb| homolog 2) (Mind bomb-2) (Skeletrophin) (Dystrophin-like protein) (Dyslike) Length = 973 Score = 34.3 bits (77), Expect = 0.15 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKV 311 VF C H C+ C AL N CPICRQP+ ++I V Sbjct: 940 VFQCGHGA-CAPCGAAL----NACPICRQPIRDRIQIFV 973
>MIB1_MOUSE (Q80SY4) Ubiquitin ligase protein MIB1 (EC 6.3.2.-) (Mind bomb| homolog 1) (DAPK-interacting protein 1) (DIP-1) Length = 1006 Score = 33.9 bits (76), Expect = 0.19 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIK 314 RDT PC H+ CS C+ ++ KC IC++ V+ +I+ Sbjct: 827 RDTLFGPCGHIATCSLCSPRVK----KCLICKEQVQSRTKIE 864 Score = 32.7 bits (73), Expect = 0.43 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEK 329 PC H+C C CA ++ KC CR VE+ Sbjct: 880 PCGHMCACENCASLMK----KCVQCRAVVER 906
>MIB1_HUMAN (Q86YT6) Ubiquitin ligase protein MIB1 (EC 6.3.2.-) (Mind bomb| homolog 1) (DAPK-interacting protein 1) (DIP-1) (Zinc finger ZZ type with ankyrin repeat domain protein 2) Length = 1006 Score = 33.9 bits (76), Expect = 0.19 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIK 314 RDT PC H+ CS C+ ++ KC IC++ V+ +I+ Sbjct: 827 RDTLFGPCGHIATCSLCSPRVK----KCLICKEQVQSRTKIE 864 Score = 32.7 bits (73), Expect = 0.43 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEK 329 PC H+C C CA ++ KC CR VE+ Sbjct: 880 PCGHMCACENCANLMK----KCVQCRAVVER 906
>MIB1_BRARE (Q804S5) Ubiquitin ligase protein mib (EC 6.3.2.-) (Mind bomb| protein) Length = 1030 Score = 33.9 bits (76), Expect = 0.19 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIK 314 RDT PC H+ CS C+ ++ KC IC++ V+ +I+ Sbjct: 825 RDTLFGPCGHIATCSLCSPRVK----KCLICKEQVQSRTKIE 862 Score = 32.7 bits (73), Expect = 0.43 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEK 329 PC H+C C CA ++ KC CR VE+ Sbjct: 878 PCGHMCACENCASLMK----KCVQCRAVVER 904
>UNK_DROME (Q86B79) Protein unkempt| Length = 599 Score = 33.9 bits (76), Expect = 0.19 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPV 335 R + PC HL +C+ CA+++ +CP C+ PV Sbjct: 564 RTVTLEPCNHLSICNTCAESV----TECPYCQVPV 594
>MIB_DROME (Q9VUX2) Ubiquitin ligase protein mind-bomb (EC 6.3.2.-) (Mind bomb| homolog) (D-mib) Length = 1226 Score = 33.9 bits (76), Expect = 0.19 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPV---EKLMEIKVRS 305 RDT PC H+ C CA ++ KC ICR+ V EK+ E V S Sbjct: 978 RDTVFKPCGHVSCCETCAPRVK----KCLICRETVSSREKIDECLVCS 1021
>MDM4_HUMAN (O15151) Mdm4 protein (p53-binding protein Mdm4) (Mdm2-like| p53-binding protein) (Mdmx protein) (Double minute 4 protein) Length = 490 Score = 33.5 bits (75), Expect = 0.25 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -3 Query: 442 PRDTAVFPCR--HLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 PRD + R HL C CA+ L+ CPIC++ ++ ++++ Sbjct: 444 PRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKV 487
>MIB1_XENLA (Q6GNY1) Ubiquitin ligase protein MIB1 (EC 6.3.2.-) (Mind bomb| homolog 1) Length = 1011 Score = 33.1 bits (74), Expect = 0.33 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIK 314 RDT PC H+ CS C+ ++ KC +C++ V+ +I+ Sbjct: 828 RDTLFGPCGHIATCSLCSPRVK----KCLLCKEQVQSRTKIE 865 Score = 32.7 bits (73), Expect = 0.43 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEK 329 PC H+C C CA ++ KC CR VE+ Sbjct: 881 PCGHMCACENCASLMK----KCVQCRAVVER 907
>RN141_BRARE (Q6IV56) RING finger protein 141| Length = 222 Score = 32.7 bits (73), Expect = 0.43 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKVRSAEP*G 290 + PC H C +C QS CP+CR V E V S P G Sbjct: 158 ILPCAH-SFCQKCIDKWSGQSRNCPVCRIQVTAANESWVMSDAPTG 202
>MIB2_HUMAN (Q96AX9) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (Mind bomb| homolog 2) (Zinc finger ZZ type with ankyrin repeat domain protein 1) (Skeletrophin) (Novelzin) (Novel zinc finger protein) (Putative NF-kappa-B-activating protein 002N) Length = 1013 Score = 32.7 bits (73), Expect = 0.43 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKV 311 VF C H C+ C AL + CPICRQP+ ++I V Sbjct: 980 VFQCGHGA-CAPCGSAL----SACPICRQPIRDRIQIFV 1013 Score = 29.3 bits (64), Expect = 4.7 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLME---IKVRSAEP 296 PC+H +C ECA+ ++ KC C+ V K + +V SA P Sbjct: 904 PCQHRTVCEECARRMK----KCIRCQVVVSKKLRPDGSEVASAAP 944
>MYLIP_MOUSE (Q8BM54) Ubiquitin ligase MYLIP (EC 6.3.2.-) (Myosin regulatory| light chain-interacting protein) (MIR) Length = 445 Score = 32.3 bits (72), Expect = 0.56 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 PC H C CA L+ CP+CR VE + + Sbjct: 401 PCGHTVCCESCAAQLQ----SCPVCRSRVEHVQHV 431
>MYLIP_HUMAN (Q8WY64) Ubiquitin ligase MYLIP (EC 6.3.2.-) (Myosin regulatory| light chain-interacting protein) (MIR) Length = 445 Score = 32.3 bits (72), Expect = 0.56 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 PC H C CA L+ CP+CR VE + + Sbjct: 401 PCGHTVCCESCAAQLQ----SCPVCRSRVEHVQHV 431
>STB3_YEAST (Q12427) Protein STB3 (SIN3-binding protein 3)| Length = 513 Score = 32.3 bits (72), Expect = 0.56 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +2 Query: 164 ILQRLCPLTRNKKKLRGLIKPHTPSLQLLFTH 259 I Q++ PL RN++ R IKPHTP + L TH Sbjct: 271 IAQKIRPLLRNRR--RSSIKPHTPFISKLNTH 300
>PEX10_MACFA (Q8HXW8) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 326 Score = 32.3 bits (72), Expect = 0.56 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 445 EPRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQ--PVEKLMEIK 314 E R PC HL C EC A +CP+CR+ P +KL+ ++ Sbjct: 279 ERRHPTATPCGHL-FCWECITAWCSSKAECPLCREKFPPQKLIYLR 323
>PEX10_HUMAN (O60683) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (RING finger protein 69) Length = 326 Score = 32.3 bits (72), Expect = 0.56 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -3 Query: 445 EPRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQ--PVEKLMEIK 314 E R PC HL C EC A +CP+CR+ P +KL+ ++ Sbjct: 279 ERRHPTATPCGHL-FCWECITAWCSSKAECPLCREKFPPQKLIYLR 323
>RNF34_MOUSE (Q99KR6) RING finger protein 34 (RING finger protein RIFF)| (Phafin-1) Length = 376 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 D + C H+ C++C + + ++CPICRQ V + + + Sbjct: 338 DCVLLECGHMVTCTKCGKRM----SECPICRQYVVRAVHV 373
>RNF34_BOVIN (Q5E9J6) RING finger protein 34| Length = 375 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 D + C H+ C++C + + ++CPICRQ V + + + Sbjct: 337 DCVLLECGHMVTCTKCGKRM----SECPICRQYVVRAVHV 372
>BIRC4_RAT (Q9R0I6) Baculoviral IAP repeat-containing protein 4 (Inhibitor of| apoptosis protein 3) (X-linked inhibitor of apoptosis protein) (X-linked IAP) (IAP homolog A) (RIAP3) (RIAP-3) Length = 496 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPIC 347 PC HL C +CA+A+ +KCP+C Sbjct: 463 PCGHLVTCKQCAEAV----DKCPMC 483
>BIRC4_MOUSE (Q60989) Baculoviral IAP repeat-containing protein 4 (Inhibitor of| apoptosis protein 3) (X-linked inhibitor of apoptosis protein) (X-linked IAP) (IAP homolog A) (MIAP3) (MIAP-3) Length = 496 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPIC 347 PC HL C +CA+A+ +KCP+C Sbjct: 463 PCGHLVTCKQCAEAV----DKCPMC 483
>RNF34_PONPY (Q5NVC7) RING finger protein 34| Length = 372 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 D + C H+ C++C + + ++CPICRQ V + + + Sbjct: 334 DCVLLECGHMVTCTKCGKRM----SECPICRQYVVRAVHV 369
>RNF34_HUMAN (Q969K3) RING finger protein 34 (RING finger protein RIFF)| (FYVE-RING finger protein Momo) (Human RING finger homologous to inhibitor of apoptosis protein) (hRFI) (Caspases-8 and -10-associated RING finger protein 1) (CARP-1) (Caspase regulat Length = 372 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 D + C H+ C++C + + ++CPICRQ V + + + Sbjct: 334 DCVLLECGHMVTCTKCGKRM----SECPICRQYVVRAVHV 369
>RNF34_RAT (Q6AYH3) RING finger protein 34 (RING finger protein MOMO)| Length = 381 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 D + C H+ C++C + + ++CPICRQ V + + + Sbjct: 343 DCVLLECGHMVTCTKCGKRM----SECPICRQYVVRAVHV 378
>MDM4_MOUSE (O35618) Mdm4 protein (p53-binding protein Mdm4) (Mdm2-like| p53-binding protein) (Mdmx protein) (Double minute 4 protein) Length = 489 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -3 Query: 442 PRDTAVFPCR--HLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 PRD + + HL C CA+ L+ CP+C++ ++ ++++ Sbjct: 443 PRDGNIIHGKTSHLTTCFHCARRLKKSGASCPVCKKEIQLVIKV 486
>BIRC4_HUMAN (P98170) Baculoviral IAP repeat-containing protein 4 (Inhibitor of| apoptosis protein 3) (X-linked inhibitor of apoptosis protein) (X-linked IAP) (IAP-like protein) (HILP) Length = 497 Score = 32.3 bits (72), Expect = 0.56 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPIC 347 PC HL C +CA+A+ +KCP+C Sbjct: 464 PCGHLVTCKQCAEAV----DKCPMC 484
>ZC3H5_HUMAN (Q9C0B0) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 32.0 bits (71), Expect = 0.73 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 430 AVFPCRHLCMCSECAQALRLQSNKCPICR 344 AV PC+H +C CA + ++CPIC+ Sbjct: 778 AVLPCQHAALCELCA-----EGSECPICQ 801
>ZC3H5_CANFA (Q6EE22) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 32.0 bits (71), Expect = 0.73 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 445 EPRDTAVFPCRHLCMCSECAQALRLQSNKCPICR 344 + ++ AV PC+H +C CA + ++CP+C+ Sbjct: 773 QEQNRAVLPCQHAVLCELCA-----EGSECPVCQ 801
>BIRC8_GORGO (Q95M71) Baculoviral IAP repeat-containing protein 8 (Inhibitor of| apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) Length = 236 Score = 32.0 bits (71), Expect = 0.73 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL C +CA+A+ ++CP+C ++ Sbjct: 203 PCGHLVTCKQCAEAV----DRCPMCNAVID 228
>ZNFP_LASSJ (O73557) Ring-finger protein Z| Length = 98 Score = 32.0 bits (71), Expect = 0.73 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -3 Query: 418 CRHLCMCSECAQALRLQSNKCPICRQPV-EKLMEIKVRSAEP*G 290 C + +C C L SN+CPIC+ P+ KL +A P G Sbjct: 43 CNNHYLCLNCLTLLLSVSNRCPICKMPLPTKLRPSAAPTAPPTG 86
>RKHD1_HUMAN (Q86XN8) RING finger and KH domain-containing protein 1| Length = 485 Score = 31.6 bits (70), Expect = 0.95 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 430 AVFPCRHLCMCSECAQALRLQSN-KCPICRQPVEKLMEI 317 A+ PC H C +CA + +S +CP CR P + + I Sbjct: 445 ALVPCGHNLFCMDCAVRICGKSEPECPACRTPATQAIHI 483
>BIRC8_PANTR (Q95M72) Baculoviral IAP repeat-containing protein 8 (Inhibitor of| apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) Length = 236 Score = 31.6 bits (70), Expect = 0.95 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL C +CA+A+ ++CP+C ++ Sbjct: 203 PCGHLVTCKQCAEAV----DRCPMCSAVID 228
>BIRC8_HUMAN (Q96P09) Baculoviral IAP repeat-containing protein 8 (Inhibitor of| apoptosis-like protein 2) (IAP-like protein 2) (ILP-2) (Testis-specific inhibitor of apoptosis) Length = 236 Score = 31.6 bits (70), Expect = 0.95 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL C +CA+A+ ++CP+C ++ Sbjct: 203 PCGHLVTCKQCAEAV----DRCPMCSAVID 228
>CBLBA_XENLA (Q6GQL0) E3 ubiquitin-protein ligase CBL-B-A (EC 6.3.2.-) (Signal| transduction protein CBL-B-A) (SH3-binding protein CBL-B-A) Length = 918 Score = 31.6 bits (70), Expect = 0.95 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLMEIKVRSAEP*GRLCCLLHMS 263 +D + PC HL MC+ C + + + CP CR ++ + I V +P C Sbjct: 392 KDVKIEPCGHL-MCTSCLTSWQESDGQGCPFCRCEIKGMEPIIVDPFDPRDESRCFSFSD 450 Query: 262 RMC 254 +C Sbjct: 451 SLC 453
>IAP2_NPVAC (P41454) Probable apoptosis inhibitor 2 (IAP-2)| Length = 249 Score = 31.6 bits (70), Expect = 0.95 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLME 320 + PCRHL +C+EC++ + +C +C + + +E Sbjct: 210 KSVCFMPCRHLAVCTECSR----RCKRCCVCNAKIMQRIE 245
>ZEF2_IRV6 (P40629) Zinc finger protein| Length = 145 Score = 31.6 bits (70), Expect = 0.95 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 9/38 (23%) Frame = -3 Query: 421 PCRHLCMCSECAQALR-------LQSN--KCPICRQPV 335 PC HL MC+ C+ L + SN KCP CR P+ Sbjct: 99 PCGHLIMCNPCSLNLNNSVCTRGVNSNYEKCPKCRTPI 136
>CHFR_MOUSE (Q810L3) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 31.6 bits (70), Expect = 0.95 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKL 326 PC H C+ C +S+ CP CR PVE++ Sbjct: 318 PCMHT-FCAACYSGWMERSSLCPTCRCPVERI 348
>CHFR_HUMAN (Q96EP1) Ubiquitin-protein ligase CHFR (EC 6.3.2.-) (Checkpoint| with forkhead and RING finger domains protein) Length = 664 Score = 31.6 bits (70), Expect = 0.95 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKL 326 PC H C+ C +S+ CP CR PVE++ Sbjct: 319 PCMHT-FCAACYSGWMERSSLCPTCRCPVERI 349
>ZNFP_LYCVA (P18541) RING finger protein Z| Length = 89 Score = 31.6 bits (70), Expect = 0.95 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = -3 Query: 418 CRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKVRSAEP 296 C +C C L S++CP+C+ P+ ++I + P Sbjct: 44 CHDHYLCRHCLNLLLSVSDRCPLCKYPLPTRLKISTAPSSP 84
>ZC3H5_MOUSE (Q8BL48) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 31.2 bits (69), Expect = 1.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 430 AVFPCRHLCMCSECAQALRLQSNKCPICR 344 AV PC+H +C CA + ++CP+C+ Sbjct: 778 AVLPCQHAVLCELCA-----EGSECPVCQ 801
>RAD5_DEBHA (Q6BIP2) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1153 Score = 31.2 bits (69), Expect = 1.2 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECA------QALRLQSNKCPICRQPVEKLMEIKVR 308 + A+ PC H C C Q LQ CP CR+P+ K K+R Sbjct: 928 EMALTPCGH-AYCLNCVLEHFDFQEKNLQKPLCPNCREPISKYKIFKLR 975
>GNAO_CAEEL (P51875) Guanine nucleotide-binding protein G(o), alpha subunit| Length = 353 Score = 31.2 bits (69), Expect = 1.2 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = +2 Query: 47 ILAATKYVH--GFTSLDAFYMFGYAQYRPRLYSCTVQFIFAILQRLCPL 187 I+ K +H GFT+ D Y QY+P +YS TVQ + AIL+ + L Sbjct: 48 IVKQMKIIHESGFTAED------YKQYKPVVYSNTVQSLVAILRAMSNL 90
>CBLB_MOUSE (Q3TTA7) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) (Casitas B-lineage lymphoma proto-oncogene b) Length = 982 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLMEIKVRSAEP--*GRLCC 278 +D + PC HL MC+ C A + + CP CR ++ I V +P G CC Sbjct: 381 KDVKIEPCGHL-MCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCC 436
>CBLB_HUMAN (Q13191) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) (Casitas B-lineage lymphoma proto-oncogene b) (RING finger protein 56) Length = 982 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLMEIKVRSAEP--*GRLCC 278 +D + PC HL MC+ C A + + CP CR ++ I V +P G CC Sbjct: 381 KDVKIEPCGHL-MCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCC 436
>CBLB_RAT (Q8K4S7) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) (Casitas B-lineage lymphoma proto-oncogene b) Length = 938 Score = 31.2 bits (69), Expect = 1.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLMEIKVRSAEP--*GRLCC 278 +D + PC HL MC+ C A + + CP CR ++ I V +P G CC Sbjct: 381 KDVKIEPCGHL-MCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCC 436
>Y044_NPVAC (P41449) Hypothetical 15.0 kDa protein in GTA-P79 intergenic region| Length = 131 Score = 31.2 bits (69), Expect = 1.2 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = -3 Query: 430 AVFP------CRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIK 314 AV+P C H C+C++C + + + N CP C+ + ++ K Sbjct: 86 AVYPAVTYLHCGHSCLCTDCDETVNV-DNTCPKCKSGIRYKLKYK 129
>MIB2_CHICK (Q5ZIJ9) Ubiquitin ligase protein MIB2 (EC 6.3.2.-) (Mind bomb| homolog 2) Length = 954 Score = 30.8 bits (68), Expect = 1.6 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEIKV 311 VF C H C +C+ AL + CPICRQ + + ++I V Sbjct: 921 VFQCGH-GSCPDCSTALTV----CPICRQAIRERIQIFV 954 Score = 29.6 bits (65), Expect = 3.6 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 424 FPCRHLCMCSECAQALRLQSNKCPICRQPVEKLME 320 FPC+H +C EC++ ++ KC C+ + K ++ Sbjct: 843 FPCQHSIVCEECSRRMK----KCIKCQVTITKKLK 873
>IAP2_DROME (Q24307) Apoptosis 2 inhibitor (Inhibitor of apoptosis 2) (dIAP2)| (DIAP) (IAP homolog A) (IAP-like protein) (DILP) Length = 498 Score = 30.8 bits (68), Expect = 1.6 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE 332 PC HL C++CA ++ CP+CR ++ Sbjct: 465 PCGHLATCNQCAPSVA----NCPMCRADIK 490
>IAP3_NPVOP (P41437) Apoptosis inhibitor 3 (IAP-3)| Length = 268 Score = 30.4 bits (67), Expect = 2.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLMEI 317 PC H+ C +CA + CP+CR ++K + + Sbjct: 235 PCGHVVACGKCAAGV----TTCPVCRGQLDKAVRM 265
>Y044_NPVOP (O10304) Hypothetical 13.0 kDa protein (ORF49)| Length = 120 Score = 30.4 bits (67), Expect = 2.1 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVE-KLMEIK 314 PC H C+C++C Q L +N C C+ V+ KL IK Sbjct: 87 PCGHSCLCTDCDQ---LFANVCFECKSAVQFKLRFIK 120
>IE61_VZVD (P09309) Transcriptional repressor IE61 (Immediate-early protein| 61) (IE61) Length = 467 Score = 30.4 bits (67), Expect = 2.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLM 323 PC H C C +A S +CP+CR PV+ ++ Sbjct: 34 PCLH-DFCFVCIRAWTSTSVQCPLCRCPVQSIL 65
>GNAO_DROME (P16378) Guanine nucleotide-binding protein G(o), alpha subunit 47A| Length = 354 Score = 30.4 bits (67), Expect = 2.1 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = +2 Query: 47 ILAATKYVH--GFTSLDAFYMFGYAQYRPRLYSCTVQFIFAILQRLCPLT 190 I+ K +H GFT+ D + QYRP +YS T+Q + AIL+ + L+ Sbjct: 49 IVKQMKIIHESGFTAED------FKQYRPVVYSNTIQSLVAILRAMPTLS 92
>RAD18_CANAL (Q5A4N5) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 378 Score = 30.4 bits (67), Expect = 2.1 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -3 Query: 439 RDTAVFPCRHLC---MCSECAQALRLQSNKCPICRQPV 335 +D P R C CS+C + L+ N+CP+C+ V Sbjct: 33 KDLLNAPVRTQCDHTYCSQCIREFLLRDNRCPLCKTEV 70
>BRE1_YARLI (Q6CF78) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 700 Score = 30.4 bits (67), Expect = 2.1 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQ-ALRLQSNKCPICRQP 338 +DTA+ C H+ C +CAQ L + KCP C +P Sbjct: 656 KDTALKVCGHV-FCHQCAQDRLDARLRKCPNCNKP 689
>GNAO_MANSE (P53359) Guanine nucleotide-binding protein G(o), alpha subunit| Length = 354 Score = 30.0 bits (66), Expect = 2.8 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 47 ILAATKYVH--GFTSLDAFYMFGYAQYRPRLYSCTVQFIFAILQRL 178 I+ K +H GFT+ D + QYRP +YS T+Q + AIL+ + Sbjct: 48 IVKQMKIIHESGFTNED------FKQYRPVVYSNTIQSLVAILRAM 87
>GNAO_LOCMI (P38404) Guanine nucleotide-binding protein G(o), alpha subunit| Length = 354 Score = 30.0 bits (66), Expect = 2.8 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 47 ILAATKYVH--GFTSLDAFYMFGYAQYRPRLYSCTVQFIFAILQRL 178 I+ K +H GFT+ D + QYRP +YS T+Q + AIL+ + Sbjct: 49 IVKQMKIIHESGFTAED------FKQYRPVVYSNTIQSLVAILRAM 88
>CBL_MOUSE (P22682) E3 ubiquitin-protein ligase CBL (EC 6.3.2.-) (Signal| transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) Length = 913 Score = 29.6 bits (65), Expect = 3.6 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALR-LQSNKCPICRQPVEKLMEIKVRSAEP*G 290 +D + PC HL MC+ C + + + CP CR ++ I V +P G Sbjct: 387 KDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRG 436
>ICP0_PRVIF (P29129) Trans-acting transcriptional protein ICP0 (Early protein| 0) (EP0) Length = 410 Score = 29.6 bits (65), Expect = 3.6 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQPVEKLM 323 + PC H C +C Q L S CP+C V ++ Sbjct: 56 EAQTLPCMHK-FCLDCIQRWTLTSTACPLCNARVTSIL 92
>CBLB_XENTR (Q6DFR2) E3 ubiquitin-protein ligase CBL-B (EC 6.3.2.-) (Signal| transduction protein CBL-B) (SH3-binding protein CBL-B) Length = 982 Score = 29.6 bits (65), Expect = 3.6 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLMEIKVRSAEP*GRLCCLLHMS 263 +D + PC HL MC+ C + + + CP CR ++ I V +P C Sbjct: 392 KDVKIEPCGHL-MCTSCLTSWQESDGQGCPFCRCEIKGTEPIVVDPFDPRDENRCCSFND 450 Query: 262 RMC 254 +C Sbjct: 451 SLC 453
>CBL_HUMAN (P22681) E3 ubiquitin-protein ligase CBL (EC 6.3.2.-) (Signal| transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) (RING finger protein 55) Length = 906 Score = 29.6 bits (65), Expect = 3.6 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALR-LQSNKCPICRQPVEKLMEIKVRSAEP*G 290 +D + PC HL MC+ C + + + CP CR ++ I V +P G Sbjct: 389 KDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRG 438
>RBBP6_HUMAN (Q7Z6E9) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) (Retinoblastoma-binding Q protein 1) (Protein RBQ-1) Length = 1792 Score = 29.3 bits (64), Expect = 4.7 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNK--CPICRQ 341 D V PC C EC + L+S++ CP C Q Sbjct: 268 DAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQ 301
>SM3L2_ARATH (Q9FNI6) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 2 (EC 3.6.1.-) (SMARCA3-like protein 2) Length = 1029 Score = 29.3 bits (64), Expect = 4.7 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNK--CPICRQPVEK 329 D + PC H +C EC A S CP+CR V K Sbjct: 803 DAVLTPCAHR-LCRECLLASWRNSTSGLCPVCRNTVSK 839
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 29.3 bits (64), Expect = 4.7 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNK--CPICRQ 341 D V PC C EC + L+S++ CP C Q Sbjct: 269 DAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQ 302
>PML_MOUSE (Q60953) Probable transcription factor PML| Length = 808 Score = 29.3 bits (64), Expect = 4.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 427 VFPCRHLCMCSECAQALRLQSNKCPICRQP 338 + PC H +CS C +A LQ CPIC+ P Sbjct: 43 LLPCLHT-LCSGCLEAPGLQ---CPICKAP 68
>ZNFP_LYCVT (P19325) RING finger protein Z (Fragment)| Length = 71 Score = 29.3 bits (64), Expect = 4.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 418 CRHLCMCSECAQALRLQSNKCPICRQPV 335 C +C C L S++CP+C+ P+ Sbjct: 44 CHDHYLCRHCLNLLLTSSDRCPLCKYPL 71
>ZNFP_LYCVP (P19326) RING finger protein Z (Fragment)| Length = 51 Score = 29.3 bits (64), Expect = 4.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -3 Query: 418 CRHLCMCSECAQALRLQSNKCPICRQPV 335 C +C C L S++CP+C+ P+ Sbjct: 24 CHDHYLCRHCLNLLLTSSDRCPLCKYPL 51
>CBLBB_XENLA (Q6NRE7) E3 ubiquitin-protein ligase CBL-B-B (EC 6.3.2.-) (Signal| transduction protein CBL-B-B) (SH3-binding protein CBL-B-B) Length = 764 Score = 29.3 bits (64), Expect = 4.7 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNK-CPICRQPVEKLMEIKVRSAEP*GRLCCLLHMS 263 +D + PC HL MC+ C + + + CP CR ++ I V +P C Sbjct: 394 KDVKIEPCGHL-MCTSCLTSWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDENRCCSFND 452 Query: 262 RMC 254 +C Sbjct: 453 SLC 455
>PML_HUMAN (P29590) Probable transcription factor PML (Tripartite motif| protein 19) (RING finger protein 71) Length = 882 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 445 EPRDTAVFPCRHLCMCSECAQALRLQSNKCPICRQP 338 E + + PC H +CS C +A +Q CPIC+ P Sbjct: 63 EAKCPKLLPCLHT-LCSGCLEASGMQ---CPICQAP 94
>DZIP3_MOUSE (Q7TPV2) Ubiquitin ligase protein DZIP3 (EC 6.3.2.-) (DAZ-interacting| protein 3 homolog) Length = 1204 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 442 PRDTAVFPCRHLCMCSECAQALRLQSNKCPICR 344 P + +V PC H S+C + +Q CP CR Sbjct: 1153 PENLSVLPCAHK-FHSQCIRPWLMQQGTCPTCR 1184
>IAP2_NPVOP (O10324) Probable apoptosis inhibitor 2 (IAP-2)| Length = 236 Score = 28.9 bits (63), Expect = 6.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPIC 347 + PCRHL +C+EC+ + +C +C Sbjct: 197 KSVCFLPCRHLVVCAECSP----RCKRCCVC 223
>CBLC_MOUSE (Q80XL1) Signal transduction protein CBL-C (SH3-binding protein| CBL-C) (CBL-3) Length = 496 Score = 28.9 bits (63), Expect = 6.2 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALR-LQSNKCPICRQPVEKLMEIKVRSA 302 +D + PC HL +CS C A + S CP CR EIK R A Sbjct: 358 KDVRIEPCGHL-LCSCCLAAWQDSDSQTCPFCR------CEIKGREA 397
>BRE1_ASHGO (Q757D9) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 643 Score = 28.5 bits (62), Expect = 8.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALRLQSNKCPICRQ 341 +DT + C H+ C + L + KCP C + Sbjct: 599 KDTVIKTCGHVFCADCCKERLAARMRKCPTCNK 631
>PFA3_GIBZE (Q4IA62) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Protein fatty| acyltransferase 3) Length = 550 Score = 28.5 bits (62), Expect = 8.1 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Frame = -1 Query: 276 CSTCRGCVNKS*SDGVW-----GLISPRSFFLFLV--SGQSLWRMANMNCTV 142 CSTCR CV K W GL + ++F LFL+ S W A C V Sbjct: 126 CSTCRRCVLKMDHHCPWLATCIGLRNHKAFLLFLIYTSLFCFWSFAVSACWV 177
>ICP0_EHV1V (P84445) Trans-acting transcriptional protein ICP0 (Infected cell| protein 0) Length = 532 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLM 323 PC H C C Q+ CP+C+ PVE ++ Sbjct: 23 PCLH-AFCYVCITRWIRQNPTCPLCKVPVESVV 54
>ICP0_EHV1B (P28990) Trans-acting transcriptional protein ICP0| Length = 532 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 421 PCRHLCMCSECAQALRLQSNKCPICRQPVEKLM 323 PC H C C Q+ CP+C+ PVE ++ Sbjct: 23 PCLH-AFCYVCITRWIRQNPTCPLCKVPVESVV 54
>MATK_AVESA (Q9MUZ6) Maturase K (Intron maturase)| Length = 511 Score = 28.5 bits (62), Expect = 8.1 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 95 FYMFGYAQYRPRLYSCTVQFIFAILQRLCPLTRNKKKLRGLIKPHT--PSLQLLFTH 259 FY Y+Q P +S V+ F++ + CP + K + L H+ P L+ F H Sbjct: 90 FYSEFYSQILPEGFSIVVEIPFSLRELSCPKEKEIPKFQNLRSIHSIFPFLEDKFLH 146
>TRI26_RAT (P62603) Tripartite motif protein 26 (Zinc finger protein 173)| Length = 542 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALR-LQSNK--CPICRQPVEK 329 RD C H+ C C +R + N+ CP+C++P +K Sbjct: 24 RDPVTIDCGHV-FCRSCTSDIRPISGNRPVCPLCKKPFKK 62
>GNAO_HELTI (P51877) Guanine nucleotide-binding protein G(o), alpha subunit| Length = 353 Score = 28.5 bits (62), Expect = 8.1 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 47 ILAATKYVH--GFTSLDAFYMFGYAQYRPRLYSCTVQFIFAILQRLCPLT 190 I+ K +H GFTS D QY+P +YS T+Q + AI++ + L+ Sbjct: 48 IVKQMKIIHEGGFTSEDT------KQYKPVVYSNTIQSLVAIIRAMGTLS 91
>CDAS_THEET (P29964) Cyclomaltodextrinase (EC 3.2.1.54) (CDase)| (Cyclomaltodextrin hydrolase, decycling) Length = 574 Score = 28.5 bits (62), Expect = 8.1 Identities = 19/69 (27%), Positives = 30/69 (43%) Frame = +3 Query: 96 FTCLGMPNIGHGFTVVLYNSYSPFSKDSAR*PETKRNFGG*SSPIHHHFSFYSHILDMWS 275 FT +G+P I +G V + Y P + E K+N F+FY ++ + Sbjct: 444 FTFVGIPYIYYGDEVGMVGDYDPDCRRCMIWEEEKQN--------KSIFNFYKKLISIRR 495 Query: 276 KQHSLPYGS 302 + L YGS Sbjct: 496 ENEELKYGS 504
>BRE1_CANAL (Q5A4X0) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 681 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQ-ALRLQSNKCPICRQ 341 +DTA+ C H+ CS+C Q L + +CP C + Sbjct: 637 KDTAITVCGHV-FCSKCTQERLAARLRRCPSCNR 669
>TRI26_MOUSE (Q99PN3) Tripartite motif protein 26 (Zinc finger protein 173)| Length = 545 Score = 28.5 bits (62), Expect = 8.1 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 439 RDTAVFPCRHLCMCSECAQALR-LQSNK--CPICRQPVEK 329 RD C H+ C C +R + N+ CP+C++P +K Sbjct: 24 RDPVTIDCGHV-FCRSCTSDIRPISGNRPVCPLCKKPFKK 62
>PEX10_YEAST (Q05568) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 337 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 436 DTAVFPCRHLCMCSECAQALRLQSNKCPICRQ 341 D + PC HL C C + + +CP+CRQ Sbjct: 295 DPSCAPCGHL-FCWSCLMSWCKERPECPLCRQ 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,759,089 Number of Sequences: 219361 Number of extensions: 1491339 Number of successful extensions: 4324 Number of sequences better than 10.0: 117 Number of HSP's better than 10.0 without gapping: 4198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4307 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
