| Clone Name | rbast39f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POL1_BRAV (Q8V5E0) RNA1 polyprotein (P1) [Contains: X1 protein; ... | 30 | 1.8 | 2 | ALG10_YEAST (P50076) Alpha-1,2 glucosyltransferase ALG10 (EC 2.4... | 29 | 3.1 |
|---|
>POL1_BRAV (Q8V5E0) RNA1 polyprotein (P1) [Contains: X1 protein; X2 protein;| Putative ATP-dependent helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (Membrane-binding protein); Viral genome-linked protein (VPg); Picornain 3C-like protease (EC 3.4.22.-) ( Length = 2094 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 23 LIHTVYVPFSSVSIIYIENAQQHSLPQPYTHPY 121 L H V VP S Y E + +LP+PY P+ Sbjct: 2056 LYHDVSVPGSDALYFYFEQRARRALPEPYIPPH 2088
>ALG10_YEAST (P50076) Alpha-1,2 glucosyltransferase ALG10 (EC 2.4.1.-)| (Alpha-2-glucosyltransferase ALG10) (Dolichyl-phosphoglucose-dependent glucosyltransferase ALG10) (Asparagine-linked glycosylation protein 10) Length = 525 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 12 VINY*FTQCMFHFPLFR*FTLKTPNSIRFHNLTP 113 +I Y F ++HF F + PN + FH +TP Sbjct: 376 LIKYFFMTPIYHFSTFAYLEVMRPNQLTFHPITP 409 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,998,513 Number of Sequences: 219361 Number of extensions: 323647 Number of successful extensions: 872 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 872 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)