| Clone Name | rbast39d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MPIP1_CAEEL (O44552) M-phase inducer phosphatase cdc-25.1 (EC 3.... | 28 | 6.9 | 2 | MXIJ_SHISO (Q55288) Lipoprotein mxiJ precursor | 28 | 6.9 | 3 | MXIJ_SHIFL (Q06081) Lipoprotein mxiJ precursor | 27 | 9.0 | 4 | FZD1_RAT (Q08463) Frizzled 1 precursor (Frizzled-1) (Fz-1) (rFz1) | 27 | 9.0 | 5 | FZD1_MOUSE (O70421) Frizzled 1 precursor (Frizzled-1) (Fz-1) (mFz1) | 27 | 9.0 |
|---|
>MPIP1_CAEEL (O44552) M-phase inducer phosphatase cdc-25.1 (EC 3.1.3.48) (Cell| division cycle-related protein 25.1) Length = 604 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 35 ATSTCTQICKPCRRITLQMTLFCVKKRSHYITLH 136 +T+ C QIC+PC I + + F ++ +S + H Sbjct: 406 STAECRQICEPCSYIPMTHSSFSMEFKSARLERH 439
>MXIJ_SHISO (Q55288) Lipoprotein mxiJ precursor| Length = 241 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/31 (38%), Positives = 22/31 (70%), Gaps = 3/31 (9%) Frame = +1 Query: 10 NNSLIQKARDEYVYTNMQ---ALSADYITND 93 N S+I ++EYVYTN+Q + ++++TN+ Sbjct: 181 NISVILTPKEEYVYTNVQPVKEIKSEFLTNE 211
>MXIJ_SHIFL (Q06081) Lipoprotein mxiJ precursor| Length = 241 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/31 (38%), Positives = 22/31 (70%), Gaps = 3/31 (9%) Frame = +1 Query: 10 NNSLIQKARDEYVYTNMQ---ALSADYITND 93 N S+I ++EYVYTN+Q + ++++TN+ Sbjct: 181 NISVILTPKEEYVYTNVQPVKEVKSEFLTNE 211
>FZD1_RAT (Q08463) Frizzled 1 precursor (Frizzled-1) (Fz-1) (rFz1)| Length = 641 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 58 YLCTRTRRVPSELNYYFL 5 + C R RVPS LNY+FL Sbjct: 268 FSCPRALRVPSYLNYHFL 285
>FZD1_MOUSE (O70421) Frizzled 1 precursor (Frizzled-1) (Fz-1) (mFz1)| Length = 642 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 58 YLCTRTRRVPSELNYYFL 5 + C R RVPS LNY+FL Sbjct: 269 FSCPRALRVPSYLNYHFL 286 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,062,410 Number of Sequences: 219361 Number of extensions: 955840 Number of successful extensions: 1377 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1377 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)