| Clone Name | rbast39d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ROB1_AGRRH (P20402) Protein-tyrosine phosphatase rolB (EC 3.1.3.... | 28 | 4.4 | 2 | MVIN_CHLMU (Q9PJB9) Virulence factor mviN homolog | 27 | 9.9 |
|---|
>ROB1_AGRRH (P20402) Protein-tyrosine phosphatase rolB (EC 3.1.3.48) (ROL B| protein) Length = 259 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +2 Query: 2 KEMSVNFKIEICTVISTTLHKYHHELAPPQLIEFLFSKRTHRRQWEPTL 148 KE S+ F +E V++TT+ Y ELA +++ H R EP L Sbjct: 114 KEQSITFGME--AVLATTIQPYRSELALQEMLRVHNLAWPHSRTEEPDL 160
>MVIN_CHLMU (Q9PJB9) Virulence factor mviN homolog| Length = 536 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -2 Query: 176 IHCKKEWLSVKLVPIVVDV 120 +HC+K++LSV L P VV+V Sbjct: 149 LHCEKKFLSVGLAPSVVNV 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,085,101 Number of Sequences: 219361 Number of extensions: 815866 Number of successful extensions: 1638 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1638 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)