| Clone Name | rbast38h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PROS_DROME (P29617) Protein prospero | 31 | 0.92 | 2 | HH_DROME (Q02936) Protein hedgehog precursor [Contains: Protein ... | 30 | 2.1 | 3 | NUDT7_MOUSE (Q99P30) Peroxisomal coenzyme A diphosphatase NUDT7 ... | 28 | 6.0 | 4 | DIS3_SCHPO (P37202) Mitotic control protein dis3 | 28 | 7.8 | 5 | ZAN_MOUSE (O88799) Zonadhesin precursor | 28 | 7.8 | 6 | ENV_FIVWO (Q05312) Env polyprotein (GP150 polyprotein) [Contains... | 28 | 7.8 |
|---|
>PROS_DROME (P29617) Protein prospero| Length = 1403 Score = 30.8 bits (68), Expect = 0.92 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +2 Query: 26 LAQKQLIRKRIAVASNRPQLHNDSQARLEYREAHPDNW*HFISKWKERASKLAFLFGNRL 205 L Q+Q+ ++ +A A+ RPQ+H+ + ARL R S+ E+ L + + Sbjct: 768 LQQQQMEQQHVATAAPRPQMHHPAPARLPTRMGGAAGHTALKSELSEKFQMLRANNNSSM 827 Query: 206 MASAGT 223 M +GT Sbjct: 828 MRMSGT 833
>HH_DROME (Q02936) Protein hedgehog precursor [Contains: Protein hedgehog| N-product (Hh-Np) (N-Hh); Protein hedgehog C-product (C-Hh) (Hh-Cp)] Length = 421 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 71 NRPQLHNDSQARLEYREAHPDNW*HFISKWKERASKLAFLFGNRL 205 N QLH D A L AH +S W+ + KL F+F +R+ Sbjct: 261 NFVQLHTDGGAVLTVTPAH------LVSVWQPESQKLTFVFADRI 299
>NUDT7_MOUSE (Q99P30) Peroxisomal coenzyme A diphosphatase NUDT7 (EC 3.6.1.-)| (Nucleoside diphosphate-linked moiety X motif 7) (Nudix motif 7) Length = 236 Score = 28.1 bits (61), Expect = 6.0 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +3 Query: 12 TNMSHLLKNN*SENE*QLQATGLSYTMTARRA*NTEKLTQITGSISFPNGRREP 173 T SHL N S L G Y M R+ +KL + G + FP G+R+P Sbjct: 30 TRYSHLSSNKFSVLVPLLARGGKLYLMFTVRS---DKLKREPGEVCFPGGKRDP 80
>DIS3_SCHPO (P37202) Mitotic control protein dis3| Length = 970 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -2 Query: 209 PSNDYRIKMPACWLSPSIWK*NATSYLGELLCILGAPGCHCVTEA 75 P + K+PA P +WK N + +L+C + PGC + +A Sbjct: 476 PEEGHNWKVPADKTHP-LWK-NRKDFRDKLICSIDPPGCQDIDDA 518
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 139 VAFHFQMEGESQQAGIFIR*SFDGQRRYQTILS 237 ++FH+ M G+ + G+F+ +F G R T+ S Sbjct: 294 LSFHYIMHGQGHEEGLFVYATFLGNIRKYTLFS 326
>ENV_FIVWO (Q05312) Env polyprotein (GP150 polyprotein) [Contains: Major| glycoprotein GP100; Glycoprotein GP36] Length = 854 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 86 HNDSQARLEYREAHPDNW*HFISKWKER 169 H D Q + + ++ P +W IS WK+R Sbjct: 368 HTDVQFQCQRTQSQPGSWIRAISSWKQR 395 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,968,401 Number of Sequences: 219361 Number of extensions: 824694 Number of successful extensions: 1872 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1872 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)