| Clone Name | rbast38f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTNN_TREPA (P96122) MTA/SAH nucleosidase (EC 3.2.2.9) (5'-methyl... | 28 | 5.7 | 2 | UQCR2_CANGA (Q6FSJ3) Ubiquinol-cytochrome-c reductase complex co... | 27 | 9.7 |
|---|
>MTNN_TREPA (P96122) MTA/SAH nucleosidase (EC 3.2.2.9) (5'-methylthioadenosine| nucleosidase) (S-adenosylhomocysteine nucleosidase) Length = 269 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 226 TSNARLVIAAPD*FSLCDRRPSWTDATQCRMMGDG 330 T+N L + F LC R P WT+ C + G G Sbjct: 120 TANTALRYLVREAFDLCTRDPEWTEGA-CALSGSG 153
>UQCR2_CANGA (Q6FSJ3) Ubiquinol-cytochrome-c reductase complex core protein 2,| mitochondrial precursor (EC 1.10.2.2) Length = 364 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 70 YQCTNMNQSVQLIRLSDISHSCSVSHTAKEYIFL 171 +Q TN +++L+R S++ C+ S +EYI L Sbjct: 54 FQNTNTKSALRLVRESELLGGCTKSTVDREYITL 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,687,354 Number of Sequences: 219361 Number of extensions: 920473 Number of successful extensions: 1974 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1974 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)