| Clone Name | rbast38b07 |
|---|---|
| Clone Library Name | barley_pub |
>PAT5_SOLTU (P15478) Patatin T5 precursor (Potato tuber protein)| Length = 386 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 342 DGAGTNEEALVRFAKRLSEERKLR 271 D T EEAL RFAK LS+ +KLR Sbjct: 357 DNPETYEEALKRFAKLLSDRKKLR 380
>PAT3_SOLTU (P11768) Patatin class 1 precursor (Patatin class I) (Potato tuber| protein) Length = 386 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 342 DGAGTNEEALVRFAKRLSEERKLR 271 D T EEAL RFAK LS+ +KLR Sbjct: 357 DSPETYEEALKRFAKLLSDRKKLR 380
>PAT2_SOLTU (P15477) Patatin B2 precursor (Potato tuber protein)| Length = 386 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 342 DGAGTNEEALVRFAKRLSEERKLR 271 D T EEAL RFAK LS+ +KLR Sbjct: 357 DSPETYEEALKRFAKLLSDRKKLR 380
>PAT0_SOLTU (P07745) Patatin precursor (Potato tuber protein)| Length = 386 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 342 DGAGTNEEALVRFAKRLSEERKLR 271 D T EEAL RFAK LS+ +KLR Sbjct: 357 DSPETYEEALKRFAKLLSDRKKLR 380
>PAT1_SOLTU (P15476) Patatin B1 precursor (Potato tuber protein) (Fragment)| Length = 377 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -3 Query: 342 DGAGTNEEALVRFAKRLSEERKLR 271 D T EEAL RFAK LS +KLR Sbjct: 348 DSPETYEEALKRFAKLLSNRKKLR 371
>MEGF6_HUMAN (O75095) Multiple epidermal growth factor-like domains 6 precursor| (EGF-like domain-containing protein 3) (Multiple EGF-like domain protein 3) Length = 1229 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +3 Query: 261 GWFGAACAPRRASWRSGRAPLHWCQHRRRSHTSHCQCLPG 380 GWFG ACA +R S G A C H T C+C PG Sbjct: 931 GWFGEACA-QRCSCPPGAA----CHH----VTGACRCPPG 961
>MET4_YEAST (P32389) Transcriptional activator of sulfur metabolism MET4| (Methionine-requiring protein 4) Length = 672 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 378 RVNIDNGMYETVDGAGTNEEALVRFAKRLS--EERKLRQTNLNS 253 RVN+ NG Y ++ AG + + + A ++ ++K+R+ N N+ Sbjct: 364 RVNVPNGAYNSLISAGFDNDQIDAIAAIMAYHHQKKIRENNSNN 407
>YB30_YEAST (P38125) Hypothetical transport protein YBR180W| Length = 572 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 290 ESLLAKRTSASSLVPAPSTVSYIPLSMFTRDTVLV 394 E + K +++ S P+P T ++IP + F++D L+ Sbjct: 77 EEVAVKSSNSQSRDPSPDTQAHIPYTYFSKDQRLI 111
>PATR_THEFY (Q47KH1) Putative phenylalanine aminotransferase (EC 2.6.1.-)| Length = 359 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -1 Query: 272 AKPTSTPSREEKRDEEALPTMLRDATRCV 186 A P P REE D EAL + D TR V Sbjct: 128 ATPIHVPLREETHDLEALAAAVTDRTRMV 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,119,800 Number of Sequences: 219361 Number of extensions: 877847 Number of successful extensions: 2275 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2275 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)