| Clone Name | rbast37b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LPXK_RHOPA (Q6NAM5) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.13... | 29 | 4.1 |
|---|
>LPXK_RHOPA (Q6NAM5) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A| 4'-kinase) Length = 340 Score = 28.9 bits (63), Expect = 4.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 36 FWHRKPQVTKRQTLFITY*FDNILGANVQK 125 FWHR P + R L I + NI A +QK Sbjct: 6 FWHRPPSLVSRLLLPIAAIYGNIAAARMQK 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,343,125 Number of Sequences: 219361 Number of extensions: 284979 Number of successful extensions: 584 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)