| Clone Name | rbast36e08 |
|---|---|
| Clone Library Name | barley_pub |
>KR1_HHV2H (P13287) Serine/threonine-protein kinase (EC 2.7.11.1)| Length = 481 Score = 32.0 bits (71), Expect = 0.40 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = -1 Query: 331 AGFHSST--ECRLSRNENDPIIVPLI-LHLA*NIVKCVSQK*ARFRYLFLDSSPSP 173 AG+++ST E RL R N P I+PL+ LH+ + V K Y +L PSP Sbjct: 221 AGWYASTSHEARLLRRLNHPAILPLLDLHVVSGVTCLVLPKYHCDLYTYLSKRPSP 276
>CATL_RAT (P07154) Cathepsin L precursor (EC 3.4.22.15) (Major excreted| protein) (MEP) (Cyclic protein 2) (CP-2) [Contains: Cathepsin L heavy chain; Cathepsin L light chain] Length = 334 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 107 REEYSQSNDSSFVNIPSGQNADMK 36 R EY+ +ND+ FV+IP + A MK Sbjct: 214 RAEYAVANDTGFVDIPQQEKALMK 237
>SIGL7_HUMAN (Q9Y286) Sialic acid-binding Ig-like lectin 7 precursor (Siglec-7)| (QA79 membrane protein) (Adhesion inhibitory recptor molecule 1) (AIRM-1) (p75) (D-siglec) (CDw328 antigen) Length = 467 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +2 Query: 50 FDQTVCSQNWNHCFESTPPEFAFSGGK*AQMHNICICIHPEWTRGGVKK*IPKP 211 F CS W C + TPP ++ G + +H P TR V IP+P Sbjct: 163 FQNLTCSVPWA-CEQGTPPMISWMGTSVSPLH-------PSTTRSSVLTLIPQP 208
>ATM_ARATH (Q9M3G7) Serine/threonine-protein kinase ATM (EC 2.7.11.1) (Ataxia| telangiectasia mutated homolog) (AtATM) Length = 3856 Score = 27.3 bits (59), Expect = 9.8 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 9/57 (15%) Frame = -1 Query: 226 SQK*ARFRYLF-----LDSSPSPFRMDANANVV----HLCSLSSREGKLGRSTLKAM 83 SQK FRY+ L++SP F D +V H+ S EGKL R ++ + Sbjct: 997 SQKEEAFRYILTLQSLLENSPGDFPDDLREEIVNGLIHIFSSVRDEGKLSRKLIECV 1053
>TPL_TREPA (P45685) Protein tpl| Length = 233 Score = 27.3 bits (59), Expect = 9.8 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 159 QMQMLCICAHFPPEKA 112 Q++M CIC H+P E+A Sbjct: 121 QLEMKCICCHYPLEEA 136
>NQRE_CHLCV (Q823P5) Na(+)-translocating NADH-quinone reductase subunit E (EC| 1.6.5.-) (Na(+)-translocating NQR subunit E) (Na(+)-NQR subunit E) (NQR complex subunit E) (NQR-1 subunit E) Length = 264 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 225 PKNKQGLGIYFLTPPLVHSGWMQM 154 PKN QG+GI F+T L+ +M + Sbjct: 183 PKNLQGMGISFITTGLIAMAFMSL 206
>NQRE_CHLPN (Q9Z8B3) Probable Na(+)-translocating NADH-quinone reductase| subunit E (EC 1.6.5.-) (Na(+)-translocating NQR subunit E) (Na(+)-NQR subunit E) (NQR complex subunit E) (NQR-1 subunit E) Length = 256 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 225 PKNKQGLGIYFLTPPLVHSGWMQM 154 PKN QG+GI F+T L+ +M + Sbjct: 183 PKNLQGMGISFITTGLIAMAFMSL 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,401,788 Number of Sequences: 219361 Number of extensions: 1002064 Number of successful extensions: 1812 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1811 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)