| Clone Name | rbast36b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COX13_THET8 (P98005) Cytochrome c oxidase polypeptide I+III (EC ... | 31 | 1.0 | 2 | ACHA3_CHICK (P09481) Neuronal acetylcholine receptor protein, al... | 28 | 8.8 | 3 | MURC_BACSK (Q5WEA8) UDP-N-acetylmuramate--L-alanine ligase (EC 6... | 28 | 8.8 | 4 | GLGA_CLOPE (Q8XPA1) Glycogen synthase (EC 2.4.1.21) (Starch [bac... | 28 | 8.8 |
|---|
>COX13_THET8 (P98005) Cytochrome c oxidase polypeptide I+III (EC 1.9.3.1)| (Cytochrome c aa(3) subunit 1) (Cytochrome caa3) (A-protein) Length = 791 Score = 31.2 bits (69), Expect = 1.0 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -2 Query: 357 VWRALRDSGPDA-DNPWNGCAHRYPMALPVPTPRRHNY 247 +W++LR SGP A DNPW G + A P P+ HN+ Sbjct: 484 MWKSLR-SGPKAPDNPWGGYTLEWLTASP---PKAHNF 517
>ACHA3_CHICK (P09481) Neuronal acetylcholine receptor protein, alpha-3 subunit| precursor Length = 496 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 63 KHLFMDRMHRLRWSGVDQGGSQHKFIHGPMGR 158 KH++ D ++LRW+ VD GG++ FI P G+ Sbjct: 79 KHIWND--YKLRWNPVDYGGAE--FIRVPSGQ 106
>MURC_BACSK (Q5WEA8) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 435 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 2 TTGMFAHVTGIKENTSAYLGEASVHGPNAST 94 TTG+ AHV G E TS +G+ + G ST Sbjct: 115 TTGLLAHVLGSVEPTSYLIGDGTGKGAANST 145
>GLGA_CLOPE (Q8XPA1) Glycogen synthase (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase) Length = 482 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 357 VWRALRDSGPDADNPWNGCAHRY 289 +WR+L D+DN WN A +Y Sbjct: 451 IWRSLIIQAMDSDNSWNKSAEKY 473 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,685,461 Number of Sequences: 219361 Number of extensions: 749057 Number of successful extensions: 2005 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2005 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)