| Clone Name | rbast36a06 |
|---|---|
| Clone Library Name | barley_pub |
>WASIP_HUMAN (O43516) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) (PRPL-2 protein) Length = 503 Score = 25.4 bits (54), Expect(2) = 2.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 128 GAPPPQPPFFSLNKNYAD 181 GAPPP PP S+ + D Sbjct: 426 GAPPPPPPSTSIRNGFQD 443 Score = 22.3 bits (46), Expect(2) = 2.6 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 50 KHGSTQSTKPKAHEHSTKSQLQQ*ITGAPPPQPP 151 ++GST P + ++S + +G PP PP Sbjct: 387 RNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP 420
>ATX2L_HUMAN (Q8WWM7) Ataxin-2-like protein (Ataxin-2 domain protein)| (Ataxin-2-related protein) Length = 1075 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 23 LYSPHFAACKHGSTQSTKPKAHEHSTKSQLQQ*ITGAPPPQP 148 +Y+ H HG T H T++ +Q IT APPP P Sbjct: 945 VYAIHHQQLPHGFTNMA------HVTQAHVQTGITAAPPPHP 980
>GPR52_HUMAN (Q9Y2T5) Probable G-protein coupled receptor 52| Length = 361 Score = 28.9 bits (63), Expect = 3.2 Identities = 24/84 (28%), Positives = 31/84 (36%), Gaps = 19/84 (22%) Frame = -1 Query: 205 LVVPCLLRICIVFI-----------------*GKEGRLWWWCSCYXXXXXXLGTMFMGFG 77 LV PC LRICI+ I G G ++ WC+ F GF Sbjct: 152 LVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCA----TSWLTSAYFTGFI 207 Query: 76 FCTLSRP-VFASC-KVWRIKSVCQ 11 C L P F C + I +C+ Sbjct: 208 VCLLYAPAAFVVCFTYFHIFKICR 231
>WASIP_MOUSE (Q8K1I7) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) Length = 493 Score = 25.0 bits (53), Expect(2) = 3.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 128 GAPPPQPPFFSLNKNYAD 181 GAPPP PP S+ + D Sbjct: 416 GAPPPPPPSTSVRNGFQD 433 Score = 22.3 bits (46), Expect(2) = 3.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 50 KHGSTQSTKPKAHEHSTKSQLQQ*ITGAPPPQPP 151 ++GST P + ++S + +G PP PP Sbjct: 377 RNGSTARALPATPQLPSRSGMDSPRSGPRPPLPP 410
>WASIP_RAT (Q6IN36) Wiskott-Aldrich syndrome protein-interacting protein| (WASP-interacting protein) Length = 487 Score = 25.0 bits (53), Expect(2) = 3.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 128 GAPPPQPPFFSLNKNYAD 181 GAPPP PP S+ + D Sbjct: 410 GAPPPPPPSTSVRNGFQD 427 Score = 22.3 bits (46), Expect(2) = 3.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 50 KHGSTQSTKPKAHEHSTKSQLQQ*ITGAPPPQPP 151 ++GST P + ++S + +G PP PP Sbjct: 371 RNGSTARALPATPQLPSRSGMDSPRSGPRPPLPP 404
>HAND1_SHEEP (Q28555) Heart- and neural crest derivatives-expressed protein 1| (Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1) (eHAND) Length = 204 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 87 MNIVPSHSYNSK*QEHHHHNLPSFP 161 MN+V S++++ HHHH P+ P Sbjct: 1 MNLVGSYAHHHHHHHHHHHPHPAHP 25 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,192,652 Number of Sequences: 219361 Number of extensions: 941455 Number of successful extensions: 2181 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2171 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)