| Clone Name | rbast35c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPA9_MOUSE (Q9D7D2) Serpin A9 precursor | 32 | 0.36 | 2 | SSN2_YEAST (P38931) Suppressor of RNA polymerase B SSN2 (SCA1 pr... | 28 | 6.8 |
|---|
>SPA9_MOUSE (Q9D7D2) Serpin A9 precursor| Length = 418 Score = 32.3 bits (72), Expect = 0.36 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 12 YRCNSDFSGLQKTHFFNISTAFH 80 + N+DFSG+ KTHF +S A H Sbjct: 333 FNSNADFSGITKTHFLQVSKAAH 355
>SSN2_YEAST (P38931) Suppressor of RNA polymerase B SSN2 (SCA1 protein)| Length = 1420 Score = 28.1 bits (61), Expect = 6.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 146 GVLYDESCMVIRFCTSLNVHSRVKCSGDVKKVSFL 42 G+L D+ M R + N+H V C D K+SF+ Sbjct: 1222 GILPDDELMNWRRLSGRNIHLAVVCVDDNSKISFI 1256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,525,255 Number of Sequences: 219361 Number of extensions: 287600 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)