ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast35a02 |
|---|---|
| Clone Library Name | barley_pub |
>NK1R_RANCA (Q98982) Substance-P receptor (SPR) (NK-1 receptor) (NK-1R)| (Tachykinin receptor 1) Length = 408 Score = 29.6 bits (65), Expect = 1.8 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +1 Query: 94 NYTGKFKSMKNEQLYTVLVPLYLCYSCSMLVM-CWYECISCLLNMWCVKLPG-SSDIWSE 267 N+ ++ K EQ+Y VLV L Y +LV+ C Y I + +W ++PG SSD + E Sbjct: 184 NWPDSEENRKYEQVYQVLV-FCLIYILPLLVIGCAYTFIG--MTLWASEIPGDSSDRYHE 240 Query: 268 PV 273 V Sbjct: 241 QV 242
>LNT_HELPY (O24982) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 425 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -3 Query: 330 ELDYFTARPFLGKSFVN--GFHWLTPD 256 E YF FLG SF++ GF WL PD Sbjct: 111 ENPYFRLLSFLGSSFIHPFGFDWLVPD 137
>LNT_HELPJ (Q9ZMQ0) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 425 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -3 Query: 330 ELDYFTARPFLGKSFVN--GFHWLTPD 256 E YF FLG SF++ GF WL PD Sbjct: 111 ENPYFRLLSFLGSSFIHPFGFDWLVPD 137
>PME3_PHAVU (Q43111) Pectinesterase-3 precursor (EC 3.1.1.11) (Pectin| methylesterase 3) (PE 3) Length = 581 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 381 KNWGPGADAVHGVPWARELDYFT---ARPFLGKSFVNGFHWL 265 +N GPGAD V WA T A F +SF+ G WL Sbjct: 529 QNSGPGADVSQRVKWAGYKPTITDRNAEEFTVQSFIQGPEWL 570
>NFS1_YEAST (P25374) Cysteine desulfurase, mitochondrial precursor (EC 2.8.1.7)| (tRNA-splicing protein SPL1) Length = 497 Score = 29.6 bits (65), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 214 DKIYIHTSTSQAYYKNSIDIKEL 146 +KIY HT +QAY K ID+ E+ Sbjct: 266 NKIYFHTDAAQAYGKIHIDVNEM 288
>RIR1_NEUCR (Q9UW15) Ribonucleoside-diphosphate reductase large chain (EC| 1.17.4.1) (Ribonucleotide reductase large subunit) Length = 929 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = +1 Query: 184 VMCWYECISCLLNMWCVKLPGSSDIWSEPVESVDEALAEEWAGGEVVELPRPWHAV 351 +MC +EC PG +D++ + E++ E +E G + V+ + W+A+ Sbjct: 350 LMCPHEC------------PGLADVYGDEFEALYEKYEKEGKGRKTVKAQKLWYAI 393
>GDC_MOUSE (Q8C0K5) Grave disease carrier protein homolog (GDC) (Mitochondrial| solute carrier protein homolog) (Solute carrier family 25 member 16) Length = 332 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 298 RQELRQRIPLAHSRCLNSQAVSRTTYSADKIYIH 197 R+ L + + L + RC+ SQAV+ TTY K + H Sbjct: 297 RRGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFH 330
>GDC_HUMAN (P16260) Grave disease carrier protein (GDC) (Grave disease| autoantigen) (GDA) (Mitochondrial solute carrier protein homolog) (Solute carrier family 25 member 16) Length = 332 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 298 RQELRQRIPLAHSRCLNSQAVSRTTYSADKIYIH 197 R+ L + + L + RC+ SQAV+ TTY K + H Sbjct: 297 RKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFH 330
>PGCA_MOUSE (Q61282) Aggrecan core protein precursor (Cartilage-specific| proteoglycan core protein) (CSPCP) Length = 2132 Score = 28.5 bits (62), Expect = 4.1 Identities = 22/66 (33%), Positives = 29/66 (43%) Frame = -3 Query: 372 GPGADAVHGVPWARELDYFTARPFLGKSFVNGFHWLTPDV*TPRQFHAPHIQQTRYTFIP 193 GPG DAV P E+ YFT P + + TP +P+ P I T +P Sbjct: 715 GPGVDAVPLEPKTTEVPYFTTEPRKQTEWEPAY---TPVGTSPQ----PGIPPTWLPTLP 767 Query: 192 AHHKHT 175 A +HT Sbjct: 768 AAEEHT 773
>RIR1_DROME (P48591) Ribonucleoside-diphosphate reductase large subunit (EC| 1.17.4.1) (Ribonucleoside-diphosphate reductase M1 subunit) (Ribonucleotide reductase large chain) Length = 812 Score = 28.5 bits (62), Expect = 4.1 Identities = 21/95 (22%), Positives = 38/95 (40%), Gaps = 4/95 (4%) Frame = +1 Query: 79 FLVTSNYTGKFKSMKNEQLYTVLVP-LYLCY---SCSMLVMCWYECISCLLNMWCVKLPG 246 FL TGK ++ + Y + +P L++ + +MC ++C PG Sbjct: 322 FLELKKNTGKEENRARDLFYALWIPDLFMKRVEANGDWSLMCPHKC------------PG 369 Query: 247 SSDIWSEPVESVDEALAEEWAGGEVVELPRPWHAV 351 D+W + E + E +E V+ W A+ Sbjct: 370 LHDVWGDEFEKLYEKYEQEGRANRTVKAQSLWFAI 404
>GDC_BOVIN (Q01888) Grave disease carrier protein (GDC) (Mitochondrial solute| carrier protein homolog) (Solute carrier family 25 member 16) Length = 330 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 298 RQELRQRIPLAHSRCLNSQAVSRTTYSADKIYIH 197 R+ L + + L + RC+ SQAV+ TTY K + H Sbjct: 295 RKGLYRGLSLNYIRCVPSQAVAFTTYELMKQFFH 328
>NFS1_CANMA (P87187) Cysteine desulfurase, mitochondrial precursor (EC 2.8.1.7)| (tRNA-splicing protein SPL1) Length = 484 Score = 28.1 bits (61), Expect = 5.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 214 DKIYIHTSTSQAYYKNSIDIKEL 146 +KI+ HT +QAY K ID+ E+ Sbjct: 251 NKIFFHTDAAQAYGKIPIDVNEM 273
>NFS1_CANAL (P87185) Cysteine desulfurase, mitochondrial precursor (EC 2.8.1.7)| (tRNA-splicing protein SPL1) Length = 488 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 214 DKIYIHTSTSQAYYKNSIDIKEL 146 +K++ HT +QAY K ID+ E+ Sbjct: 255 NKVFFHTDAAQAYGKIPIDVNEM 277
>FA10_CHICK (P25155) Coagulation factor X precursor (EC 3.4.21.6) (Stuart| factor) (Virus-activating protease) (VAP) [Contains: Factor X light chain; Factor X heavy chain; Activated factor Xa heavy chain] Length = 475 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = -2 Query: 235 SRTTYSADKIYIHTSTSQAYYKNS---IDIKELVQY 137 S TT++A+KI++H+ Y N I +KE +Q+ Sbjct: 305 SETTHTAEKIFVHSKYIAETYDNDIALIKLKEPIQF 340
>PACC_YARLI (P78978) pH-response transcription factor pacC/RIM101| Length = 585 Score = 27.3 bits (59), Expect = 9.1 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 333 RELDYFTARPFLGKSFVNGFHWLTPDV*TPRQFHAPHIQQTRYTF--IPAHH 184 +E D F + LG + + P P +FH PH RY F PA H Sbjct: 397 QETDQFLNQ--LGSNIYGNIKSVDPQYEAPAEFHLPHPMGYRYAFSHAPAPH 446
>RIR1_MOUSE (P07742) Ribonucleoside-diphosphate reductase large subunit (EC| 1.17.4.1) (Ribonucleoside-diphosphate reductase M1 subunit) (Ribonucleotide reductase large chain) Length = 792 Score = 27.3 bits (59), Expect = 9.1 Identities = 21/95 (22%), Positives = 41/95 (43%), Gaps = 4/95 (4%) Frame = +1 Query: 79 FLVTSNYTGKFKSMKNEQLYTVLVP-LYLCY---SCSMLVMCWYECISCLLNMWCVKLPG 246 FL TGK + + + + +P L++ + +MC EC PG Sbjct: 311 FLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNEC------------PG 358 Query: 247 SSDIWSEPVESVDEALAEEWAGGEVVELPRPWHAV 351 ++W E E + E+ ++ +VV+ + W+A+ Sbjct: 359 LDEVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAI 393 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,254,150 Number of Sequences: 219361 Number of extensions: 1047214 Number of successful extensions: 3398 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 3298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3398 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
