| Clone Name | rbast33e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL2_ENTFA (Q839G1) 50S ribosomal protein L2 | 34 | 0.076 | 2 | CDC24_SCHPO (O75004) Cell division control protein 24 | 31 | 0.84 | 3 | RL2_STRR6 (Q8CWV5) 50S ribosomal protein L2 | 29 | 3.2 | 4 | RL2_STRPN (Q97SV2) 50S ribosomal protein L2 | 29 | 3.2 | 5 | TBG_PLAFO (P34787) Tubulin gamma chain (Gamma tubulin) | 28 | 5.5 | 6 | TLP1_PRUPE (P83332) Thaumatin-like protein 1 precursor (PpAZ44) | 28 | 7.1 |
|---|
>RL2_ENTFA (Q839G1) 50S ribosomal protein L2| Length = 276 Score = 34.3 bits (77), Expect = 0.076 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 5/80 (6%) Frame = +1 Query: 118 RHTLFHQGINRVRRARLMNSASCNQSMAAIPWTI-----RSAHTVGSHSEGFLEVAVVAN 282 R T+ HQG R+ R+++ ++AA+ TI RSA+ H E ++ ++A Sbjct: 48 RITVRHQGGGHKRQYRVIDFKRNKDNVAAVVKTIEYDPNRSANIALVHYEDGVKAYILAP 107 Query: 283 AGIPMNLLALAGPGADPFVG 342 G+ + + ++GP AD VG Sbjct: 108 KGLEVGMRLVSGPEADIKVG 127
>CDC24_SCHPO (O75004) Cell division control protein 24| Length = 501 Score = 30.8 bits (68), Expect = 0.84 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = -2 Query: 185 HDAEFIRRARRTLLIP*WNRVWRYEQNYMDFVFNSTPLSVELLQKKD*QRK*SDSW 18 HD + ++ LLIP W+ VW N+ D + + +L + D + K DSW Sbjct: 237 HDFPKLLDKQQYLLIPFWSTVWEGSTNWQDGMIG----ILVILSENDFEEKKCDSW 288
>RL2_STRR6 (Q8CWV5) 50S ribosomal protein L2| Length = 277 Score = 28.9 bits (63), Expect = 3.2 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 5/80 (6%) Frame = +1 Query: 118 RHTLFHQGINRVRRARLMNSASCNQSMAAIPWTI-----RSAHTVGSHSEGFLEVAVVAN 282 R T+ HQG R RL++ ++ A+ TI RSA+ H ++ ++A Sbjct: 48 RITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYIIAP 107 Query: 283 AGIPMNLLALAGPGADPFVG 342 G+ + ++GP AD VG Sbjct: 108 KGLEVGQRIVSGPEADIKVG 127
>RL2_STRPN (Q97SV2) 50S ribosomal protein L2| Length = 277 Score = 28.9 bits (63), Expect = 3.2 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 5/80 (6%) Frame = +1 Query: 118 RHTLFHQGINRVRRARLMNSASCNQSMAAIPWTI-----RSAHTVGSHSEGFLEVAVVAN 282 R T+ HQG R RL++ ++ A+ TI RSA+ H ++ ++A Sbjct: 48 RITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKAYIIAP 107 Query: 283 AGIPMNLLALAGPGADPFVG 342 G+ + ++GP AD VG Sbjct: 108 KGLEVGQRIVSGPEADIKVG 127
>TBG_PLAFO (P34787) Tubulin gamma chain (Gamma tubulin)| Length = 452 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 124 TLFHQGINRVRRARLMNSASCNQSMAAIPWTIRSAHTVGSH 246 T H+G+ R+R +L+N N + + +S H V H Sbjct: 329 TQVHKGLQRIRDRKLVNFIKWNPASIQVTLAKQSPHVVSQH 369
>TLP1_PRUPE (P83332) Thaumatin-like protein 1 precursor (PpAZ44)| Length = 246 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +1 Query: 181 SCNQSMAAIPWTIRSAHTVGSHSEGFLEVAVVANAGIPMNLLALAGPG 324 SCN + AA P T+ + + F +V++V +PM++ G G Sbjct: 102 SCNGNGAAPPATLVEITIASNGGQDFYDVSLVDGFNLPMSVAPQGGTG 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,585,594 Number of Sequences: 219361 Number of extensions: 799451 Number of successful extensions: 1899 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1897 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)