| Clone Name | rbast33c03 |
|---|---|
| Clone Library Name | barley_pub |
>ROC2_NICSY (Q08937) 29 kDa ribonucleoprotein B, chloroplast precursor (CP29B)| Length = 291 Score = 32.7 bits (73), Expect = 0.25 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 276 VDLDGRQIRVTVAESKPREQ 217 VDLDGR IRV+ AE +PR Q Sbjct: 271 VDLDGRSIRVSAAEERPRRQ 290
>ROC2_NICPL (P49314) 31 kDa ribonucleoprotein, chloroplast precursor (CP-RBP31)| Length = 292 Score = 32.3 bits (72), Expect = 0.32 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 276 VDLDGRQIRVTVAESKPREQ 217 +DLDGR IRV+ AE +PR Q Sbjct: 272 IDLDGRSIRVSAAEERPRRQ 291
>Y190_CHLPN (Q9Z8Z4) Hypothetical protein CPn_0190/CP0577/CPj0190/CpB0193| Length = 452 Score = 28.9 bits (63), Expect = 3.6 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -1 Query: 269 LTAGRSGLPWQSRSRGSKGGFKIS*LWLEINHVLRKC*FVVSTTI 135 LT+G SG W+S S+ + G F S L + C + STT+ Sbjct: 284 LTSGISGFTWKSASKSNDGSFPFSALRHKETESDTDCFQITSTTL 328
>ROC1_ARATH (Q9ZUU4) Putative ribonucleoprotein At2g37220, chloroplast| precursor Length = 289 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 273 DLDGRQIRVTVAESKP 226 DLDGRQIRV+ AE++P Sbjct: 269 DLDGRQIRVSEAEARP 284
>ROC2_ARATH (Q43349) 29 kDa ribonucleoprotein, chloroplast precursor| (RNA-binding protein cp29) Length = 342 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 273 DLDGRQIRVTVAESKP 226 DLDGRQIRV+ AE++P Sbjct: 322 DLDGRQIRVSEAEARP 337
>YG1T_YEAST (P53227) Hypothetical 31.0 kDa protein in BUD9-RME1 intergenic| region Length = 271 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -1 Query: 239 QSRSRGSKGGFKIS*LWLEINHVLRKC*FVVSTTIFSRLMR 117 Q+ +KGGF IS L L++N +K ++ST + + R Sbjct: 146 QTEDNATKGGFNISKLTLKVNKPFKKPKRILSTNVVNESNR 186
>PGK_CAEEL (P91427) Probable phosphoglycerate kinase (EC 2.7.2.3)| Length = 417 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 61 NELHG*QKSSGIQIHFPVSLINREKIVVETTN 156 NEL K+ G+QIH PV + +K + T+ Sbjct: 266 NELLEAAKAKGVQIHLPVDFVIADKFAEDATS 297 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,897,302 Number of Sequences: 219361 Number of extensions: 548147 Number of successful extensions: 1218 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1218 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)