| Clone Name | rbast27e10 |
|---|---|
| Clone Library Name | barley_pub |
>SYM_HAEIN (P43828) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 682 Score = 29.3 bits (64), Expect = 5.4 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 8/48 (16%) Frame = +3 Query: 234 YLSQGGAVYTESTGHEAGASTYL---DPECYH-----RPDDFLKDLDF 353 Y++ GA ++S G ASTYL DPEC + +D ++DLDF Sbjct: 324 YVTVDGAKMSKSRGTFIQASTYLNHIDPECLRYYYAAKLNDRIEDLDF 371
>Y869_MYCLE (Q9CCF6) Hypothetical protein ML0869| Length = 229 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 253 RYIRNLLVMRRELPPIWTPSAIIALMIS 336 RYIR+L+ RR ++TPSA++ L I+ Sbjct: 124 RYIRDLVDARRNALGLFTPSALVLLFIT 151
>THIG_BORPE (Q7VTE5) Thiazole biosynthesis protein thiG| Length = 265 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 159 SMDSSYTKELTWLVRRTNCGQNFDE 233 ++D+S T+ +T +RRTN GQN DE Sbjct: 34 ALDASGTQIVTVAIRRTNIGQNPDE 58
>THIG_BORPA (Q7W3P5) Thiazole biosynthesis protein thiG| Length = 265 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 159 SMDSSYTKELTWLVRRTNCGQNFDE 233 ++D+S T+ +T +RRTN GQN DE Sbjct: 34 ALDASGTQIVTVAIRRTNIGQNPDE 58
>THIG_BORBR (Q7WF21) Thiazole biosynthesis protein thiG| Length = 265 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +3 Query: 159 SMDSSYTKELTWLVRRTNCGQNFDE 233 ++D+S T+ +T +RRTN GQN DE Sbjct: 34 ALDASGTQIVTVAIRRTNIGQNPDE 58
>RPOA_SHFV (Q68772) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP1 Length = 3596 Score = 28.5 bits (62), Expect = 9.2 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +3 Query: 171 SYTKELTWLVRRTNCGQNFDEYLS---QGGAVYTESTGHEAGASTYLDPECYHRPDDFLK 341 +Y+K L GQ+ EY + G + S G+ GA YLD CY P D K Sbjct: 2928 AYSKSLPAARFSVPRGQDPAEYGTPALSGPTLQLLSAGYVPGAKHYLDEACYANPFDVFK 2987
>PRIB_VIBPA (Q87L73) Primosomal replication protein n| Length = 100 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 4 RRVRCKCEIFMYSLRSILIVAHLVQGSSIHV 96 R+V C+ + + LRS I +LVQGS+I V Sbjct: 44 RQVYCRMPVVVSGLRSQAITQNLVQGSNIKV 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,603,764 Number of Sequences: 219361 Number of extensions: 995837 Number of successful extensions: 2572 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2572 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)