| Clone Name | rbast27d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MGLL_MOUSE (O35678) Monoglyceride lipase (EC 3.1.1.23) (MGL) | 29 | 2.6 | 2 | PMPC_CHLMU (Q9PJY1) Probable outer membrane protein pmpC precurs... | 28 | 4.4 | 3 | MGLL_RAT (Q8R431) Monoglyceride lipase (EC 3.1.1.23) (MGL) | 28 | 7.5 | 4 | PCSK5_MOUSE (Q04592) Proprotein convertase subtilisin/kexin type... | 27 | 9.8 |
|---|
>MGLL_MOUSE (O35678) Monoglyceride lipase (EC 3.1.1.23) (MGL)| Length = 303 Score = 29.3 bits (64), Expect = 2.6 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +2 Query: 137 TPGRIDSSLLVKNYSHKGTHIYGDKSFYPSSPLLKKC--KVCFGL 265 T GRIDSS+L +N S + Y S PL+ + KVCFG+ Sbjct: 175 TLGRIDSSVLSRNKS--------EVDLYNSDPLVCRAGLKVCFGI 211
>PMPC_CHLMU (Q9PJY1) Probable outer membrane protein pmpC precursor (Polymorphic| membrane protein C) Length = 1460 Score = 28.5 bits (62), Expect = 4.4 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 14/61 (22%) Frame = +2 Query: 131 AKTPGRIDSSLLVKNYSHKGTH------IYGDKSFY--------PSSPLLKKCKVCFGLC 268 +K GR S L +NY+HKG+ +YG FY S PLL + + +G Sbjct: 1220 SKMIGRSKSLKLERNYTHKGSEYSYQASVYGGSPFYLTINKEAGRSLPLLLQGVISYGYI 1279 Query: 269 K 271 K Sbjct: 1280 K 1280
>MGLL_RAT (Q8R431) Monoglyceride lipase (EC 3.1.1.23) (MGL)| Length = 303 Score = 27.7 bits (60), Expect = 7.5 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 143 GRIDSSLLVKNYSHKGTHIYGDKSFYPSSPLL--KKCKVCFGL 265 GRIDSS+L +N S + Y S PL+ KVCFG+ Sbjct: 177 GRIDSSVLSRNKS--------EVDLYNSDPLICHAGVKVCFGI 211
>PCSK5_MOUSE (Q04592) Proprotein convertase subtilisin/kexin type 5 precursor (EC| 3.4.21.-) (Proprotein convertase PC5) (Subtilisin/kexin-like protease PC5) (PC6) (Subtilisin-like proprotein convertase 6) (SPC6) Length = 1877 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 224 SSPLLKKCKVCFG-LCKVCPTGEGTYAAANFISC 322 + P CK C G LC CPTG + A SC Sbjct: 1209 NQPCHSSCKTCNGSLCASCPTGMYLWLQACVPSC 1242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,658,330 Number of Sequences: 219361 Number of extensions: 976659 Number of successful extensions: 2300 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2300 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)